KEGG   Acidisarcina polymorpha: ACPOL_6022Help
Entry
ACPOL_6022        CDS       T05576                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abas  Acidisarcina polymorpha
Pathway
abas00020  Citrate cycle (TCA cycle)
abas00480  Glutathione metabolism
abas01100  Metabolic pathways
abas01110  Biosynthesis of secondary metabolites
abas01120  Microbial metabolism in diverse environments
abas01130  Biosynthesis of antibiotics
abas01200  Carbon metabolism
abas01210  2-Oxocarboxylic acid metabolism
abas01230  Biosynthesis of amino acids
Module
abas_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abas_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACPOL_6022
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACPOL_6022
Enzymes [BR:abas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACPOL_6022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AXC15266
UniProt: A0A2Z5G9N0
Position
complement(6446238..6447638)
Genome map
AA seq 466 aa AA seqDB search
MQNSYNGFPLPEGGEAIQYAGGKFQIPNHPIIPFIEGDGTGRDIWRASQRVFDAAVEKAY
GGKRSVKWYEIYAGEKAYRQFGTWLPDESVNAARDLRVSIKGPLTTPVGGGIRSLNVALR
QILDLYACVRPVKYYSGVPSPVKHPEKLDIVLFRENTEDVYAGIEFKQGTEDAKRIIDFL
NKDLLKNTKKRVREDSGVGIKPISIFGTKRLVRYAIKHALESGRKTVTLVHKGNIQKFTE
GAFREWGYEVAVDEFRDSVVTERESWILGNKDANADLSVEQNAALIEPGLEFGSDDFRKE
LYAEVKHVLETIGATHGNGKWKQKLLINDRIADSIFQQIIIRPEDYSVLAAPNLNGDYIS
DAAAAQVGGLGIAPGANIGDGYAVFEATHGTAPKYADKDVINPGSVLLSGVMMFEFLGWG
EAAKLIESSLEKTIQQKFVTYDFERQMQGATKAKTSEFATRMIENM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacagttataacggtttccctttgccggaaggcggcgaggccatccagtacgcc
ggcggcaagttccaaatacccaatcatccgatcattccattcatcgaaggcgatggaacg
ggccgcgacatttggcgtgcttcgcagcgggtcttcgatgcagcggtcgaaaaggcttac
ggcggcaagcgctccgtgaagtggtacgagatctacgcaggagagaaggcctatcggcaa
ttcggaacatggcttccggatgaatcagtgaacgcggcgcgcgacctccgcgtctcgatc
aaagggccactcacaacccccgtcggcggcggcattcgctcattgaatgtggcgcttcgg
cagattctcgatttatatgcctgcgtccggccggtgaagtattactccggcgttccgagc
ccggtaaaacatccggagaagctcgacatcgttctattccgagagaacaccgaagacgtt
tacgccggcatcgagttcaaacagggaaccgaagatgccaagcgcatcatcgatttcctc
aacaaggacctgctgaaaaacaccaagaagcgcgtccgtgaggattcgggggttggcatc
aagcctatctccatcttcggaaccaagcggctggttcgctacgccatcaaacacgcgctt
gagtccggacggaagaccgtgacgctggtccacaagggaaatatccagaagtttaccgaa
ggcgcttttcgtgaatggggatacgaggtcgcggtcgacgagttccgtgattccgtcgtc
accgagcgagagagctggatcctcggcaacaaggatgcgaatgccgacctcagcgtcgag
cagaacgccgccttgatcgagcccggactcgagttcggctccgacgactttcgtaaagaa
ctctacgccgaagtgaagcacgtgctcgagacgatcggcgctacccatggcaacggcaaa
tggaagcagaaactcctgatcaatgaccggatcgccgattcgatctttcagcaaattatt
attcgtcctgaagactacagcgttctcgccgcgcccaatctgaacggcgattatatttcg
gacgcagccgcggcccaggtcggcggacttggcatcgctcctggagccaacatcggcgac
ggctacgcggtcttcgaggcgactcacggcaccgcgccaaagtatgccgacaaggatgtg
atcaatccgggatcggtcttgctttccggagtgatgatgtttgagtttctcggttggggc
gaggctgcgaagctgattgagtcctcgctggaaaagaccatccagcagaagttcgtgacc
tacgacttcgaacgccagatgcaaggggcgaccaaggccaagaccagcgaattcgcaaca
agaatgattgagaacatgtga

DBGET integrated database retrieval system