KEGG   Acidobacteriaceae bacterium SBC82: ACPOL_6655Help
Entry
ACPOL_6655        CDS       T05576                                 

Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
abas  Acidobacteriaceae bacterium SBC82
Pathway
abas00360  Phenylalanine metabolism
abas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abas00790  Folate biosynthesis
abas01100  Metabolic pathways
abas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ACPOL_6655
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACPOL_6655
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACPOL_6655
Enzymes [BR:abas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     ACPOL_6655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AXC15867
UniProt: A0A2Z5GAH1
Position
complement(7030191..7030952)
Genome map
AA seq 253 aa AA seqDB search
MITAMGKPEAEAASSYLVQQDWAAYTAEQHGIWAELVRRRMPELREHACAEYLAGFEAIG
LQEDSIPNLTEISQRLEPRTGWNSTPVSGFLPPAAFFEMLAGRRFPTTTWLRGRESLEYI
PQPDIFHDVFGHVPMHAHPVFADFLQQYGKVCAALHDKDALERMGRLFWFTVEFGVIRQG
GQIKLYGSGLISSPGESQHVLRALNGSGPEIRDFNLDQVLNQKFLVSEMQKVLYAVDSFE
QIYDAAREAERRL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgataactgcgatgggaaagccggaagcggaagcagctagttcctacctggtacagcag
gactgggccgcgtatacggcagagcagcatgggatctgggccgaactcgtccgccgccgc
atgcctgagcttcgcgagcacgcttgtgcggagtatctcgccggcttcgaagcaatcggt
ttgcaggaggactcgattccaaaccttaccgagatcagccagcgcctggagcctcgaacc
ggatggaattccacaccggtgagtggatttctgcctccggcggccttcttcgagatgctg
gctggccggcgatttcccacgaccacctggctacgcggtcgtgagtcgctcgaatacatc
ccccagcccgatatttttcacgatgtcttcggacacgttcccatgcatgctcatccggtc
ttcgccgattttctgcaacagtatggaaaggtgtgcgcggccttgcatgacaaggatgca
ttggaacgcatggggaggctcttctggtttacggtcgagtttggcgtcattcgccagggc
ggccaaatcaaactctacggaagtggtttgatctcttcgccaggagaatctcagcacgtc
ctgcgggcgttgaatgggagtgggccagagatccgggattttaacctggatcaggtgctg
aaccagaagtttcttgtctctgaaatgcagaaggtgctctacgcagtcgactcgttcgag
cagatctatgatgctgcccgtgaggccgaacgccgtctatag

DBGET integrated database retrieval system