KEGG   Brevefilum fermentans: CFX1CAM_0748
Entry
CFX1CAM_0748      CDS       T04881                                 

Gene name
oraS
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit alpha
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
abat  Brevefilum fermentans
Pathway
abat00472  D-Arginine and D-ornithine metabolism
abat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CFX1CAM_0748 (oraS)
Enzymes [BR:abat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CFX1CAM_0748 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: SMX53813
UniProt: A0A1Y6K2B6
Position
I:837643..838008
AA seq 121 aa
MTDDRIARFEQRREKYKTMSDEALKEHFWDLCNQLVAPIAELARTHTSPSIERAVLLRMG
IDSLSAHGVVDRVLQAGLLGKGAGHVLLRVAEKQGCDIREAAAAILEDKDILNNLFEEVT
Q
NT seq 366 nt   +upstreamnt  +downstreamnt
atgacagatgatcgcatcgcccggtttgaacaacgccgggaaaaatacaaaacaatgtcg
gatgaagcgttaaaagaacatttttgggacctttgcaaccagcttgtcgcaccgatagcc
gagctggctcgtacacatacatccccctcgatcgagcgcgctgtgttgctgcgtatgggc
attgacagcttgagcgcgcatggggtggtggatcgggtgctccaggcaggactgctgggc
aagggcgccgggcacgtgcttttgcgtgtggcagaaaagcagggttgtgatattcgagaa
gctgctgccgccatcctggaggataaggatatcctgaataatttgtttgaggaggtgaca
caatga

DBGET integrated database retrieval system