KEGG   Brevefilum fermentans: CFX1CAM_0749
Entry
CFX1CAM_0749      CDS       T04881                                 

Gene name
oraE
Definition
(GenBank) D-ornithine 4,5-aminomutase subunit beta
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
abat  Brevefilum fermentans
Pathway
abat00472  D-Arginine and D-ornithine metabolism
abat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CFX1CAM_0749 (oraE)
Enzymes [BR:abat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CFX1CAM_0749 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: SMX53814
UniProt: A0A1Y6K2F4
Position
I:838005..840215
AA seq 736 aa
MSALKPLNPNEKMDIEAILTDLENYRPLRKGWVWRKVMEDGVDMGPFHFRNMSEPLKNSI
GLPASKYFDDIDPQPECVVTTEIASGRFEDDLRRMRMAAWHGADHLMVIRTTGQSHIDGL
MEGTPEGVGGVPITRKQIRASRKACDLIEEEVGRPINFHSYVSGVAGPEVAVLFAEEGVN
GAHQDPQYNVLYRNINMYRSFVDAAEAKLVMTAGQIFQIDGAHNANATAKAGWLVMPELL
VQHGINCAYSLASGMPKELIGLSTVPPNSPPAPKLWYDLPYAVALRDFFSDFKMRAQQNT
RYIESDIEEAIRTHTIDTLISMLTSADIQSTITPDEGRNVPWHYNNIRGVQTVKQTWSAL
DGIKELLSLKMDGPLGEMARDIKERAVGFLEEILEVGGYFAAVEQGFFVDSAQYPERSGD
GIARDGQGGVAADSIVPRDPDYLAPVCAHFGNNNLPEGLDRPCDLIGGCTLCHPEKIVYI
DELDPEDSADRRLQETYPYRKGHLIRPEVEWAGDGTVLVQLMVPEQEDYAREAGLEIARR
MGLDDPQVINLMVLHPAEGCYLEVKGKVTFDVDRDTLKIPEKIELLPEEELREAVLKVGL
TVVAGTVGEDEHSVGLREILDIKHGGIEKYGVKYHYLGTSVPISKMIDAAIETGAQAILI
STIISHGDIHRIQMKRLVELCQERGIRDRLILIAGGTQVTPDMAAETGLDAAFGRGTKGI
EVVDAMVKTLKQRGVL
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgagcgcattaaaaccgcttaatcccaatgaaaagatggatattgaagccatcctgacg
gacctggagaattaccgtccgctgcgcaaaggctgggtgtggcgtaaagtcatggaagat
ggcgtcgacatgggaccgtttcactttcgtaatatgtcagagccattaaaaaacagcatc
ggtctgccggcatcgaagtattttgacgatatcgatccgcaacccgagtgcgtggtgacc
acagaaattgcttctggtcgctttgaggatgacctgcggcggatgcgcatggcagcctgg
catggcgcggaccacctgatggtgatccggaccaccgggcagagccatattgatgggttg
atggagggcactcctgagggtgtgggcggtgtgccgatcacgcgcaagcagatcagagcc
agccgcaaagcctgtgacctgattgaagaagaggttgggcgaccaattaacttccacagc
tacgtttctggcgtggctgggcctgaggtggctgtgttgtttgctgaagaaggcgtcaat
ggggctcaccaggacccgcagtacaacgtgctttaccgcaacatcaacatgtatcgttct
tttgtggatgcggctgaagccaagctcgtgatgacagcaggtcagattttccagattgac
ggggcgcataatgccaatgctaccgccaaagccggctggctggtgatgcccgagctgctg
gtgcagcatgggattaactgcgcttattcgcttgcttcggggatgcccaaggagctgatc
gggctctccacggtgccgcccaactcaccaccggcgccaaaattatggtacgacctgccc
tacgcagtggctttacgcgatttcttctctgatttcaagatgcgcgcccaacaaaataca
cgttacattgaatcggatatcgaagaggccattcggactcacacgattgacaccctgatc
tcgatgctgaccagcgccgatatccaaagcaccatcacccctgatgaggggcgcaacgtg
ccctggcattacaacaatatccgcggtgtgcagacggttaagcagacctggtcagccctg
gatgggattaaagaactgctcagcctaaagatggacggtccattgggtgagatggcgcgc
gatattaaagagcgcgcagtgggcttcctggaagaaatcctcgaggtcggtgggtacttt
gccgcagttgagcaaggcttctttgtggactcggctcaataccctgaacgcagcggtgat
ggcattgcccgggacggtcagggcggggtggcggctgattcgatcgtgccgcgcgacccc
gattacctggcaccggtgtgcgctcattttgggaacaacaacctgccggagggattggat
cgtccgtgtgatttgatcggaggctgcacgctctgccatccggaaaaaattgtctatatc
gacgagctggatcctgaggattcagcggaccgacgtttgcaggagacctatccataccgc
aagggtcatctgatacgacccgaggtggaatgggcaggcgacgggacggttctggtgcag
ttgatggttcccgagcaagaggattacgcccgcgaagccggcctggaaatcgcccgccga
atgggattggatgacccccaggtgatcaacctgatggtgttgcacccggcagaaggctgc
tatcttgaggttaaagggaaggtgacctttgacgtggatcgcgacactttgaagatcccc
gagaaaatcgaattacttcccgaagaggaactgcgtgaagcggttttgaaggtcggcttg
acagtggttgcaggtacggtcggagaagacgagcacagtgttggtctgcgagaaatcctg
gacatcaaacacggcggcatcgaaaaatatggcgtcaagtaccattacctgggcacctcg
gtgccgatcagcaagatgatcgatgccgcaattgaaaccggtgctcaggcgattctgatc
tcgacgatcatcagccacggcgatatccaccgcatccagatgaagcgactggttgagctc
tgccaggaaagaggcatccgtgacaggctgattctgatcgctggcggcacacaggtgaca
cctgatatggctgctgaaaccggactggacgctgccttcggacgcggcaccaagggcatt
gaagtggtcgatgcgatggtgaaaacactcaagcaacgcggcgtgctgtag

DBGET integrated database retrieval system