KEGG   Acinetobacter baumannii AB030: IX87_03645Help
Entry
IX87_03645        CDS       T03375                                 

Definition
(GenBank) carnitine dehydratase
  KO
K23463  (Z)-2-((N-methylformamido)methylene)-5-hydroxybutyrolactone dehydrogenase [EC:1.2.1.-]
Organism
abau  Acinetobacter baumannii AB030
Brite
KEGG Orthology (KO) [BR:abau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IX87_03645
Enzymes [BR:abau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     IX87_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AIL77758
Position
complement(677439..678908)
Genome map
AA seq 489 aa AA seqDB search
MTADFQLYINGQFESGAATFESINPATGEVWAHMPEARTDEVNRAVQAASRALKAPEWAG
LTASQRGKLLYKLADLIEKAAPQLAQIETSDTGKIIRETSSQIAYVAEYYRYYAGIADKL
EGSFLPIDKADMQAWIVREPVGVIAAIVPWNSQLFLSAVKVGPALAAGCTVVLKASEDGP
GPLLAFAKLVHEAGFPAGVVNVITGFGPECGAVLSSHPDVAHVAFTGGPETARHIVRNSA
ENLAKVSLELGGKSPFIVFADADIQSAVNAQVAAIFAATGQSCVAGSRLLVEESIKDEFV
QRLVERVQTIKIGLPHEMATEFGPLCTLRQRQKIEQVVASSILQGAKLLTGGKSLERAGY
YYPPTILDCTDAPQADCITTELFGPVLSVDSFKDEAEAVQKANSTPYGLAAGVFTTNLSR
AHRMTKVIGSGIVWLNTYRAVSPLAPFGGHGLSGHGREGGANAVLDYTTTKTVWLRTSDE
PIDDPFVMR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagactttcagctttatattaatggtcagtttgaatctggtgcagcgactttt
gaaagtattaatcctgcaacaggtgaagtctgggcacacatgccggaagctcgaaccgat
gaagtcaaccgagcagttcaggcggcatctcgggcattaaaagcaccggagtgggcaggt
ttaacggcttcccagcgtggtaaattgctctataagttggctgatttaattgaaaaagct
gcaccgcaacttgcccaaattgaaaccagtgatacgggcaaaattattcgtgaaacatcg
agccagattgcctatgtcgctgaatattatcgctactatgcaggtattgccgacaaatta
gagggaagttttctaccgattgataaggcagacatgcaagcatggattgttcgtgaacca
gtaggcgtgattgctgcaattgttccttggaacagccagttatttctatcggcagtaaag
gttggcccagctttagcggcaggttgtaccgtcgtgctaaaagcctctgaagacggtcct
ggaccattattggcttttgctaaattggtccatgaggcgggttttccggctggagtggtc
aatgtaattactggtttcggacctgaatgtggcgccgtgctgagcagtcatccggacgtt
gctcatgttgcgtttacaggtggtccagaaacggcacggcatattgtgcgtaactcggct
gaaaatcttgcaaaagtttcactcgaattaggtggcaaatcaccatttattgtatttgct
gatgcagatattcaaagtgcggtaaacgctcaggtcgctgctatttttgctgcaacaggg
cagagttgtgtagcaggttcacgcttactggttgaagaaagcattaaagatgaatttgtt
caacgtttggttgagcgcgtacaaaccataaaaattggtttaccccatgaaatggccacc
gagtttggaccgctttgtaccttacgccaacgccaaaaaatcgagcaagtcgttgcaagt
tcaatcctgcaaggtgcaaaactgcttactggtggtaaaagccttgagcgagcagggtat
tactatccaccgaccattttagattgcactgatgcacctcaagcagattgcattaccacg
gaactatttggtccggtgttatcagtagatagtttcaaagatgaagcggaagccgtgcaa
aaagccaatagtacgccttacgggttggcagcaggcgtttttaccaccaatttaagccgt
gcacaccgcatgactaaagtgattgggtcgggaattgtttggctcaatacttaccgcgct
gtttctccacttgcgccttttggtggacatgggctttcgggacatgggagggaaggtggc
gcaaatgcggttctagattacaccaccaccaaaacagtttggttacgtacctcagatgag
ccaattgatgacccatttgtcatgagataa

DBGET integrated database retrieval system