KEGG   Acinetobacter baumannii AB030: IX87_10760Help
Entry
IX87_10760        CDS       T03375                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00970  Aminoacyl-tRNA biosynthesis
abau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abau00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IX87_10760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abau03029]
    IX87_10760
Enzymes [BR:abau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     IX87_10760
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     IX87_10760
Mitochondrial biogenesis [BR:abau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    IX87_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AIL79090
UniProt: V5VA62
Position
2078208..2078522
Genome map
AA seq 104 aa AA seqDB search
MSTSDAQHSADLNAQTVSAIANLARLSLNDTQSAEYAQSLNKILGMMETLKGIDTEGVEP
LKSPFDNPQPLRADVVTESNHRDEYQAVAPATQDGLYLVPRVIE
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatcggatgcacagcattcagcagatttaaatgcacaaacagtttcagcaatc
gccaatcttgctcgattgtcgctcaatgatacgcaatctgctgaatatgctcaaagtcta
aataaaattttaggcatgatggaaaccttaaaaggcattgatacggaaggcgtagaacct
ttaaagagtccttttgacaatcctcaacctttacgtgctgatgtggtaactgaaagcaat
catcgggatgaataccaagcagttgcacctgcaactcaagatggtttgtatcttgttcct
cgcgtgattgaataa

DBGET integrated database retrieval system