KEGG   Acinetobacter baumannii AB030: IX87_14990Help
Entry
IX87_14990        CDS       T03375                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
abau  Acinetobacter baumannii AB030
Pathway
abau00640  Propanoate metabolism
abau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IX87_14990
Enzymes [BR:abau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     IX87_14990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AIL79868
UniProt: A0A0E1FL24
Position
2923401..2926007
Genome map
AA seq 868 aa AA seqDB search
MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQLVRRADAENLTAYLTQ
LIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGDPSKVNPVVPTQLIVDH
SLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFKNVDVIPAGNGIMHQINLEKM
SPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGGLEAENVMLGRASWMRLPDIIGV
ELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFFGEGADSMSVGDRATISNMTPEYGA
TAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKEIGLWASEMTKAEYPRVLRFDLSTVTR
NIAGPSNPHARVSTADLKEKGIAGVVENRDDGLMPDGAIIIAAITSCTNTSNPRNTVAAG
LLARKANELGLVRKPWVKSSFAPGSKAAALYLEEAGVLKDLEKLGFGIVAYACTTCNGMS
GALDPAIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDI
EKDALGHDKEGNPIYLKDIWPSDAEIDALVKQAVKPEQFRKVYIPMFDLGEVEQAKSPLY
DWRPQSTYIRRPPYWEGALAAPRTLANMRPLAILGDNITTDHLSPSNAILMDSAAGEYLH
KMGVPEEDFNSYATHRGDHLTAQRATFANPKLYNEMVRRSDGTIKQGSKARVEPEGEVMR
MWEAIETYMNRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGM
GVLPLEFKPGVNRKTLKLDGTELYSVIGNIAPRSTLTLVIERATADGKEEILEVPVTCRL
DTEEEVSVYEAGGVLQRFAQDFLEGQVA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaataccgtaaaccgctggcaggtacccagcttgaatattacgacgtgcgt
caagccgttgaagatattcagccaggcgcatacgaaaaactgccttacacctctaaagta
ctcgcagagcaattggtacgccgtgccgatgctgagaacttaactgcttatttaacgcag
ttgattgaacgccgtcaggacttggactttccttggtatcctgcgcgcgtggtgtgtcat
gacatcttgggacaaactgcattggttgaccttgcaggtttgcgtgatgcgattgctgag
aagggcggcgacccatctaaagttaacccggttgtaccaacacagctcattgtcgaccac
tctttagcagtggaatatggtggtgctgacccagacgcttttgcaaaaaaccgtgctgtt
gaagaccgccgtaacgaagaccgtttccactttattgagtggaccaaaactgcatttaaa
aatgtcgatgtgatccctgcggggaacggtattatgcaccagattaacctagagaaaatg
tctccggtgattcaggcgcgtgatggcgtagcattcccagacacatgtgtcggtacagac
tcacatacaccacatacagacgctttgggcgtaatttctgtgggtgtaggtggtttagaa
gctgaaaacgtaatgttgggccgtgcatcttggatgcgtctgccagacattattggtgtt
gagttggttggtcagcgtcaggcaggcattactgcaacagatatcgtacttgctctaact
gaattcttgcgtaaagagcgtgtggttggtgcttaccttgagttctttggtgaaggcgct
gacagtatgtctgtgggtgaccgtgcaaccatttcgaacatgacaccagaatatggcgct
acggctgcgatgttctacattgaccaaaacacaatcgactacttacgcctaacaggccgt
gaagatgctcaagtggcattggttgaacagtacgcaaaagaaatcggcctttgggcatct
gaaatgaccaaagcagagtacccacgtgtactacgttttgatctatcgacagtcacacgt
aacattgctggcccatcaaacccgcatgcgcgcgtttcaactgccgaccttaaagaaaaa
ggcattgcaggtgttgttgaaaaccgcgacgatggcttaatgccagatggcgcaatcatt
attgctgcaattacttcatgtaccaacacttctaacccacgtaacaccgtggcggcaggt
ttgttggcacgtaaggcaaatgagctaggtttggttcgtaaaccttgggtgaaatcatca
tttgcaccgggttcaaaagcggctgcactttaccttgaagaagcaggtgttctaaaagac
ttagagaaacttggttttggtattgtggcttatgcttgtacaacgtgtaacggtatgtct
ggtgcgttagatccagctatccagcaagaaattattgaccgtgacttgtacgcaaccgca
gtactctctggtaaccgtaacttcgatggccgtatccatccttatgcaaaacaagcgttc
ttggcatctccgccgcttgttgtggcatatgcaattgcaggtacgatccgttttgacatc
gaaaaagatgcgttaggtcatgacaaagaaggtaacccgatttacctcaaagacatctgg
ccatctgacgctgaaattgatgccttagttaagcaagccgtgaagcctgaacagttccgt
aaagtctacattccaatgtttgacttgggcgaagttgaacaagcgaagagcccactttac
gactggcgtccgcaaagtacttacatccgccgtccaccatattgggaaggggcgttggct
gcaccacgtactttggcgaacatgcgtccgcttgcgattttgggtgacaacatcaccacc
gaccatttgtcaccttcaaatgcgattttgatggattcggctgcgggtgaataccttcac
aaaatgggcgtaccagaagaagactttaactcatacgcaacgcaccgtggtgaccacttg
actgcacaacgtgcaacatttgcaaacccgaaactctataacgaaatggttcgccgttca
gacggtactattaagcaaggttcaaaagcacgtgtagagccagaaggcgaagtgatgcgt
atgtgggaagcaattgaaacctacatgaaccgtaaacagccgttaattattatcgcgggt
gctgactacggtcagggttcaagccgtgactgggctgcaaaaggtgtacgccttgcgggt
gttgaagcgattgtggcagaaggttttgagcgtattcaccgtaccaacttggtgggtatg
ggcgtgttaccgcttgagtttaaaccgggtgtaaaccgtaagactttaaaactagatggt
acagagctttatagcgtgattggtaatattgcgccgcgttcgactttaactttagtgatt
gaacgtgccacagcggatggtaaagaagagattcttgaagtacctgtgacttgccgttta
gatacagaagaagaagtttctgtatatgaagcgggcggtgtattacagcgttttgcgcaa
gactttttagaaggccaagtggcttaa

DBGET integrated database retrieval system