KEGG   Alphaproteobacteria bacterium WS11: D5400_01760Help
Entry
D5400_01760       CDS       T05798                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00270  Cysteine and methionine metabolism
abaw00480  Glutathione metabolism
abaw01100  Metabolic pathways
Module
abaw_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D5400_01760
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D5400_01760
Enzymes [BR:abaw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     D5400_01760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AZN70170
UniProt: A0A3Q8XNN5
Position
362575..363519
Genome map
AA seq 314 aa AA seqDB search
MAKSLKVAVQMDHVQSINIEGDSTFAMCLEAQARGHELYHYTPDLLTLRDGKVFARIEPM
TVKDEKGAHYTLGDPVRTDLSTMDVVLLRQDPPFDMAYITSTHLLERIHPQTLVVNDPAW
VRNSPEKIFVTEFPDLMPETLITRDWAEIRAFREEMGDIILKPLYGNGGAGVFHLAEGDR
NLSSLLEMFNQMFREPIIAQRYLPKVREGDKRIILIDGEPVGAINRVPAEHDSRSNMHVG
GKAVKTELTDREREICARIGPALRERGFILVGIDVIGDVMTEINVTSPTGIREVRKFGGA
DIAALMWDAIEKRR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtcattgaaagtggcggtccagatggaccatgtgcagtcgatcaacatcgaa
ggcgactccaccttcgccatgtgcctggaagcgcaggcgcggggccacgagctctatcat
tacacgcccgacctcttgacgctgcgcgacgggaaggtgtttgcccgcatcgaaccgatg
acggtgaaggacgagaagggcgcgcattacacgctgggcgatccggtgcgcaccgatctt
tccaccatggacgtggtgctcttgcgccaggacccgcctttcgacatggcctatatcacc
tcgacgcacctcctggagcgcatccatccgcagacgctcgtcgtcaacgatccggcctgg
gtgcgcaattcgcccgagaagattttcgtaactgagtttccggacctgatgccggaaacg
ctgatcacccgtgactgggccgagatccgcgcgtttcgcgaggaaatgggcgacatcatc
ctgaagccactttacggcaatggcggcgccggcgtgttccacctggcggaaggcgatcgc
aacctctcgtcgctcttggaaatgttcaaccagatgttccgcgagccgatcatcgcgcag
cgctacctgccgaaggtgcgcgaaggcgacaagcgcatcatcctcatcgacggcgaaccg
gtcggcgccatcaaccgcgtgccggccgagcacgacagccgctccaacatgcatgtgggc
ggcaaggcggtgaagacggagctgaccgatcgcgaacgcgaaatctgcgcacgcatcggg
ccagccttgcgcgaacgcggcttcattctcgtcggcatcgacgtgatcggcgacgtcatg
accgagatcaacgtcacctcgccgaccggcatccgcgaagtgcgcaagtttggcggtgcc
gacattgctgctctgatgtgggatgcgatcgaaaagcgccgctga

DBGET integrated database retrieval system