KEGG   Alphaproteobacteria bacterium WS11: D5400_09050Help
Entry
D5400_09050       CDS       T05798                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00670  One carbon pool by folate
abaw01100  Metabolic pathways
abaw01120  Microbial metabolism in diverse environments
abaw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    D5400_09050
Enzymes [BR:abaw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     D5400_09050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AZN71398
UniProt: A0A3S9B358
Position
complement(1928734..1929639)
Genome map
AA seq 301 aa AA seqDB search
MNAVIGLKQHQSTHIAASIEVAPKQAIESDDLPGLFPHGTRVYITDIGTATDEMVAAAIR
IRSLGYEPVPHLACRRLTTRVALTDRVERLSREAGVRDALIIGGGLERQAGEFSSTMEVL
ETGLFDRFGFTDLGVAGHPEGSPEFNEEVALHALRLKKSFAERTGARMRIVTQFGFDAER
FIDWSEGLRMEGIDLPVHLGVAGPAKITTLIKYAALCGIGNSVTFLKKNALALTALATSH
SPETVVGPIERHVAATPHSAIKQIHVFPFGGLKKSAEWLEQRGSWDIKTSLYPSMPLIAE
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtcatcggattgaagcagcatcaaagtacccatatcgccgcctcgatcgaa
gtggcgccgaagcaggccatcgaatccgacgacctgcccggcctctttccgcatggcacc
cgagtctacatcacggacatcgggacggcgaccgacgagatggttgcggcggcaatccgc
atccgcagtctcggctatgaaccggtgccgcatttggcctgccggcgcctgaccacgagg
gtggcgctgacagatcgcgtcgagcgcctgtcccgcgaagccggcgtcagggatgcgctc
atcatcggcggtgggctcgagcgccaggcgggcgagttttcatcgaccatggaagttctc
gaaaccggtcttttcgaccgcttcggcttcaccgatctcggcgtcgcgggccatcctgaa
ggcagtcccgagttcaacgaggaagtggcgctgcacgcgctccgccttaagaagtcgttc
gccgagcggaccggcgcgcgcatgcgcatcgtcacgcagttcggttttgacgctgaacgc
ttcatcgactggagcgagggactgcgcatggaaggcatcgaccttcccgtgcatctcggt
gtcgccgggcctgccaagatcacgacgttgatcaaatatgccgcgctttgcggcatcggc
aattcggtgacgttcctcaagaagaacgcgcttgcgctgacggcgcttgccacgagccac
tcgcccgaaacggtcgtcgggcccatcgagcgccatgttgccgccacacctcattccgcg
atcaagcagatccacgtctttccgttcggcggcctgaaaaagtccgcagagtggcttgaa
caacgtggctcatgggatataaagacatctttatatccttctatgcccctgattgcggaa
cgctga

DBGET integrated database retrieval system