KEGG   Georhizobium profundi: D5400_11130Help
Entry
D5400_11130       CDS       T05798                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
abaw  Georhizobium profundi
Pathway
abaw00471  D-Glutamine and D-glutamate metabolism
abaw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D5400_11130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abaw01011]
    D5400_11130
Enzymes [BR:abaw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     D5400_11130
Peptidoglycan biosynthesis and degradation proteins [BR:abaw01011]
 Precursor biosynthesis
  Racemase
   D5400_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AZN73751
UniProt: A0A3Q8XRQ3
Position
2340062..2340916
Genome map
AA seq 284 aa AA seqDB search
MDERGPVLVFDSGIGGLTVLREMRVLLPGKRLVYVADDAAFPYGAWEEEALRTRMVALFE
KLIAAHRPSIAVIACNTASTLALGDLRAAYPKLAFVGTVPAIKPAAERTRSGLVSVLATP
GTVKRQYTRDLISDWATKCHVRLVGSTELAGLAETYMREGFVDEDAVRAEIAPCFVERDG
NRTDIVVLACTHYPFLVNRMRKTAPWPVDWLDPSEAIARRAVSVLNGDGAGADRARAFEA
ESRAEVSPDMALFTSGKPDPAIRRLMHGFGLRVPDDLAAHNFSV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcgcgggccggtcctcgttttcgattcgggcatcggcgggctgaccgtgctg
cgcgaaatgcgggtgcttttgcctgggaagcggctcgtctacgtggccgacgatgcggcg
tttccctatggcgcgtgggaagaggaagcgctgcggacacgcatggtggcgctgtttgag
aagctgatcgcggcgcaccggccatcgatcgcggtgatcgcctgcaacaccgcttcgacg
ctggcgctgggtgatctgcgcgcggcctatcccaaacttgctttcgtcggcacggtgccg
gccatcaagcctgcggcggagcgcacgcggtcgggtctcgtatcggtgctggcgacgcca
ggaaccgtgaagcggcaatatacgcgggatctcatcagcgactgggcgacgaagtgccat
gtgaggctggtcggcagcacagaactggcggggcttgccgaaacctatatgcgcgaaggc
ttcgtggacgaagacgcggtgcgagcggagattgcgccgtgtttcgtggagcgcgacggc
aaccgcaccgatatcgtcgtgcttgcctgcacgcactatccgtttctcgtcaaccgcatg
cgcaagaccgcgccgtggccggtggattggctcgacccgtccgaggcgatcgctaggcgg
gccgtgagcgtgctgaatggtgacggtgcgggcgccgaccgggcacgtgcgttcgaagca
gaatcacgcgcggaggtgagccccgatatggctctcttcacgtccggcaagccagatcca
gcgatccggcgactgatgcacggcttcgggctgcgcgtcccagacgatcttgcagcgcac
aatttttccgtctga

DBGET integrated database retrieval system