KEGG   Alphaproteobacteria bacterium WS11: D5400_11850Help
Entry
D5400_11850       CDS       T05798                                 

Definition
(GenBank) cysteine desulfurase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
abaw  Alphaproteobacteria bacterium WS11
Pathway
abaw00450  Selenocompound metabolism
abaw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D5400_11850
Enzymes [BR:abaw01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     D5400_11850
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     D5400_11850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP SelA Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AZN71878
UniProt: A0A3Q8XPD5
Position
2478034..2479275
Genome map
AA seq 413 aa AA seqDB search
MDARTARNGYDVEAIRRDFPILSREVYGKPLVYLDNGASAQKPQAVIDAITHAYSNEYAN
VHRGLHFLSNAATDAYEASRSKVKRFLNAASEDEIVFTKSTTEAINTVAYGYGMPHIGEG
DEIVLTIMEHHSNIVPWHFIRERQGAKLVWVPVGDDGSFDLDAFAASLTERTKLVAITHM
SNVLGTVIPVKEVCRIAHERGIPVLVDGSQAAVHMPVDVRDIDCDFYVFTGHKVYGPSGI
GVLYGKTEMLKKMRPFQGGGEMIVDVSEEGVTYNEPPHRFEAGTPPIVQAIGLGAALDYM
DSIGREAIAAHEADLTAYAREKLQSVNALRVIGDAPGKGAIFSFEIEGIHAHDVSMVIDR
SGVAVRAGTHCAQPLLKRFGVTSTCRASFGMYNTRKEVDVLVEALEKARAFFA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccgcaccgcacgcaatggctatgacgtcgaagcgatccgccgcgacttcccg
atcctttcccgggaagtctacggcaagccgctggtctatctcgacaatggcgcatcggcg
cagaagccgcaggcggtgatcgatgcgatcacgcacgcttactcgaacgagtatgcgaac
gtgcatcgcgggctgcatttcctgtcgaatgcggcgaccgatgcctatgaggcatcgcgc
agcaaggtgaagcgcttcctcaatgctgcatccgaagacgagatcgtctttacgaagtcg
acgacggaggcgatcaacaccgtcgcctacggttacggcatgccgcatatcggcgagggt
gacgagatcgtgctgacgatcatggagcatcactccaatatcgtgccgtggcatttcatc
cgcgagcggcagggcgcaaagctcgtctgggtgccggtcggtgacgacgggtccttcgat
ctcgatgcgtttgctgcgagcctcacggagcgcacgaagctggtggcgatcacccacatg
tcgaacgtgctcggcaccgtcatcccggtcaaggaggtttgccgcatcgcgcacgagcgt
ggcatccccgtgctcgtcgatggcagccaggcggccgttcacatgccggtggatgtccgc
gacatcgattgcgatttctacgtcttcacggggcacaaggtgtacggtccgtccggcatc
ggcgtgctctacggcaagaccgagatgctgaagaagatgcggcccttccagggcggcggc
gagatgatcgtcgacgtatcggaagagggtgtgacgtacaacgagccgccgcatcgcttc
gaggccgggacgccgccgatcgttcaggcgatcgggctcggcgctgcgctcgactacatg
gacagcatcggccgcgaagcgattgccgcccacgaagcggatctgacggcctatgcgcgc
gagaagcttcagtcagtcaacgcgctgcgcgtgatcggcgatgcgccgggcaagggcgca
atcttctccttcgagatcgagggcatccacgcccatgacgtgtcgatggtgatcgatcgc
tcgggcgtggcggttcgagcgggtacccactgcgcgcagccgctcttgaagcgtttcggc
gtgacctccacatgcagggcatccttcgggatgtacaacacgcgcaaggaagtggatgtc
cttgtggaagcgcttgaaaaagcgcgtgccttcttcgcctga

DBGET integrated database retrieval system