KEGG   Acinetobacter baumannii ZW85-1: P795_1275Help
Entry
P795_1275         CDS       T02954                                 

Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P795_1275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:abaz02022]
    P795_1275
Two-component system [BR:abaz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   P795_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AHB89980
Position
complement(276501..277265)
Genome map
AA seq 254 aa AA seqDB search
MSLVVPAEHPETVHNETDRVERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDASQMDRLL
QRELFSLIVLDFMLPVEDGLSICRRLRQSNIDTPIIMLTARGSDSDRIAGLEAGADDYLP
KPFNPNELLARIRAVLRRQVREVPGAPSQQVEVVSFGPWSLDLSTRTLTREGQIVTLTTG
EFAVLKALVQHPREPLTRDKLMNLARGREWGAMERSIDVQVSRLRRLIEDNPARARYIQT
VWGVGYVFVPDGAE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagttgtacctgctgaacatcctgaaaccgtacataacgaaacggatcgtgtc
gagcgcattttagtggtcgatgacgatgtgcgtttacgtaccctcttgcaacgttttttg
gaagataaaggctttgttgtaaaaactgcccatgatgcctcacaaatggatcgtttatta
caacgtgagttattttcacttatcgtgctcgactttatgttgcccgttgaagatggttta
agtatttgtcgtcgtttacgtcagtcaaatattgatactccaattatcatgttaactgca
cgtggtagtgactctgaccgtattgctggtcttgaagccggcgcagatgactatttacca
aaaccctttaacccaaatgaacttttagcacgtattcgcgcagtattgcgtcgtcaggta
cgtgaagtcccgggtgcgccaagccaacaagttgaagtggttagcttcggtccatggtct
ctagatttatctacacgtacactaactcgtgaaggacaaatcgttacattgactacaggt
gaatttgccgtattaaaagctttggtacagcatccacgtgaacctttaacacgcgacaag
ctcatgaacttggctcgtggccgtgaatggggtgcaatggaacgttctattgatgttcaa
gtgtctcgtctacgccgcttaattgaagataacccggcacgcgcacgttacattcaaact
gtatggggcgtaggctatgtgtttgttccggatggtgctgaataa

DBGET integrated database retrieval system