KEGG   Acinetobacter baumannii ZW85-1: P795_15510Help
Entry
P795_15510        CDS       T02954                                 

Definition
(GenBank) exonuclease V, beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    P795_15510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:abaz03400]
    P795_15510
Enzymes [BR:abaz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     P795_15510
DNA repair and recombination proteins [BR:abaz03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     P795_15510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 PDDEXK_1 AAA_25
Motif
Other DBs
NCBI-ProteinID: AHB92827
Position
complement(3362184..3365882)
Genome map
AA seq 1232 aa AA seqDB search
MNSRVQVSYQPIIDIEFSGLHLIEASAGTGKTYTLSSLMVRIFLEKYLPGQVIATTFTRA
AAAELKSRIRARLVETHRYLDAKRSLTEKEILLQAEQESDLLLQHILKHFATRIAYACER
LKLVIDQLDELFVGTLDSFSQKLLREFAFESGKIERAQITDDAKTYSRQLIHDVLREWIQ
SQPQTVIDALYLAGELKSVDSFVKLVEDSLNFSSAHFKLPEKPTIQFEQFAQLKQLAAEI
DISLLEPYYSLDGEHYKHVSGTIFRNGAFNKLFSECLPQLLQVLKQSDSILIFDGSLAVH
RELVFKFLGQLADQKVFKKCPAEISDGFYQHPCIQQIQQLFGVLKNYAEQFDQLHIYLKA
YLCVEVKKRLPQVLQNKGETTFSQQIRTLSEALKGEQGQRFAVFVQARYPLILVDEFQDT
NQDQDDMLASIWRHPERYQKGCMIMVGDRKQAIYGFRGGDMLTFLNAYKDIQAKHGREYK
LIHNHRSVADLVEVVDALFQRQIDFGEQVQYDPIRAGTRPHPVLIDQNQPNPHPLRWLML
KDKETEAQQVAWKIRDLLNQSHAGQLYFQKDAQTQTLNEDDIAVLSRNHDGLDKVQFELE
RLGIRVNRPSKRSVFDCTIAQDVGALLTAILHPYDEAKVKRALISRLFAMDLKQLLQLEQ
TAEGLSQFMTGFDTIRELWSAQGFLVAWQQCLNQFGIWKNLVAVQSKDNERVVVNLRHLT
EILSQHSEKYQGAQNLYHWYLKQLQSPLDREWELERRLSSEAGVQLMTIHQSKGLEFKIV
FLLGADKPFRENNKTLNFSTQDITVPESAQTLTQRVVAIADKTYLNEIELKQHEERALAE
QNRLWYVALTRASHRVYALLQDTDGKSVSGLAFWKNRAEPFQHRCCTDEIILEQPPAARH
LNQHINIIEIQAQHFPDQRFYSRGKTSFSYLAQHLRHKVGTDLLASQSHEAVLAEDELDQ
VISVEAPAAQPINWIKSNFPRGTLAGNFLHEIFEHIDFQCSDEWVSEIRRRFKNDYSSLW
QDLLIKYQESFPEEQEAEYSIYHAVAEWLQEILSTPLYQGFRLNQLQPEHYLSECPFYLA
LSDRVLAMKRIQQLFAEYGMEMPELLEARSARYLNGSIDLVYFDGQRYHIADYKSNYLGE
NLADYSVESIAQSMSLASYWLQAGLYLVALHRYLKVKMQNYDIEQHLGGATYLYLRGMNG
EAEQGYYYWQPSTEFVLRLDAILGYFAEDKIA
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaagagtacaggtgtcttatcaacctattattgatattgaatttagtggactg
catttaattgaggcttcggcaggtactggaaaaacctatacattgtcgagtttaatggtc
cgtatttttcttgagaaatatttaccgggccaagtcattgcaacaacattcacccgtgct
gctgcggctgagttaaaaagccggattcgtgcgcgtttggtcgaaacccaccgttattta
gatgccaagcggagcttgactgaaaaagagatccttttgcaggccgagcaagaatctgac
ttattactgcaacatattctcaagcattttgcgacacgtattgcctatgcctgtgagcgt
ttaaagctcgttatcgatcagttagatgagctgtttgtcggaacacttgatagctttagc
caaaagctattacgtgagtttgcctttgaaagtggcaaaattgaacgtgctcaaattacc
gatgacgctaaaacctatagccgacaactgattcatgatgttttacgtgaatggatacag
tctcagcctcaaaccgtgattgatgcgttgtatctggcaggtgagttaaaaagtgtcgac
agttttgtcaaattggtcgaagactcactgaattttagttcggctcattttaaacttccc
gaaaagcctaccattcagtttgaacagtttgctcagctcaaacagctggcagcagaaatt
gatatcagtcttctagaaccatattactcgcttgatggcgaacactataaacatgtaagc
ggtacaatatttcgtaatggggcatttaataagttatttagtgaatgtttgccacagtta
ttacaagttttaaagcaaagcgacagtattttaatttttgatgggtctttggcagtacat
cgggaactcgtttttaagtttttaggccagcttgccgatcagaaagttttcaagaaatgt
cctgccgaaatttcggatggattttatcagcatccttgtattcagcagattcagcagtta
tttggtgtgctgaaaaactatgctgaacagttcgatcagcttcatatttatttaaaagcc
tatttgtgtgtagaggttaaaaaacgtttaccacaggttttacaaaacaagggcgagacg
actttttctcagcaaattcgcactttgtcagaagctttaaagggtgagcaggggcaacgt
ttcgccgtatttgtgcaggctcgataccccttaattttggttgatgagtttcaagacacc
aaccaagaccaagatgacatgctcgccagcatttggcgtcatccagaacgttaccaaaaa
ggttgcatgattatggtgggtgaccgtaagcaggcaatttacggtttccgtggtggggat
atgctcaccttcttgaatgcctacaaagatattcaggcaaagcatggtcgcgaatataag
ttaattcataaccaccgttcagtcgctgacttggttgaagtggttgatgccttatttcaa
aggcaaatcgactttggtgaacaggttcaatatgacccgattcgggcagggactcgacct
catccggttttaattgatcaaaaccagcctaatccgcatcctttacgttggctcatgcta
aaagacaaggaaacggaagcacagcaagtcgcgtggaaaatacgtgatttactcaatcag
tcacatgcaggacaactttattttcaaaaagatgctcagactcaaaccttaaatgaagat
gatattgcggtcttgtcgcgtaatcatgatggtcttgataaagttcaatttgaattagaa
cgtttaggaatacgagttaatcggccatcaaaacgaagtgtttttgactgcacaattgct
caggatgttggggccttactcactgcgattcttcatccttacgatgaggccaaagtgaaa
cgagctttgattagccgtttatttgctatggaccttaaacagctgttgcaactcgagcaa
acggccgaaggtttaagccagtttatgacgggttttgatactattcgggaattgtggtca
gctcagggctttttagtagcatggcagcaatgtttaaaccaatttggcatttggaaaaat
ctggttgctgtccagagtaaagataatgagcgggttgtggtgaacttgcgtcatttgacc
gaaattttgagccaacatagcgagaaatatcagggcgcgcaaaatctctatcactggtat
ctcaagcaattacaatcaccgcttgatcgtgaatgggagttagagcgtaggttgtcgagt
gaagctggcgtacagctcatgaccattcaccagtcaaaaggtcttgagtttaaaattgtc
tttttgctcggggccgacaagccatttcgggaaaataacaaaacacttaacttctcgacc
caagatataacggttccggagtcggctcaaaccctaacacaacgtgttgttgcgattgcc
gataaaacatatttaaacgaaatcgagctgaagcagcatgaagaacgggctttggcggaa
caaaaccgtctatggtacgttgctttaacccgggcaagtcatcgtgtttatgcgctctta
caagatacggatggcaagtctgtttcaggtttggcattttggaaaaacagagcggaacca
ttccagcaccgttgttgtaccgatgaaataattttggagcaaccacctgctgcaagacat
ttaaatcaacacatcaatattattgagatacaggcgcagcattttcctgatcagcgcttt
tattcgagaggcaaaaccagttttagttatctggcacagcatttaagacataaagtaggt
acagatttactcgcgagtcagagccatgaagctgttttagccgaagatgaactcgatcag
gttatttctgttgaggcgcccgcagcacagccaattaactggatcaaaagtaattttccg
agagggacgctcgcaggtaatttcttacatgaaatttttgagcatattgattttcaatgt
tcagatgagtgggtaagtgaaatacgtcgtcgttttaaaaatgactacagtagtttgtgg
caagatttattaatcaaataccaagaaagctttcccgaagaacaagaagcggaatattcg
atttatcacgctgtagccgaatggttgcaagagattttaagcacgccgttatatcaaggc
tttcgcctaaatcagttacagccagagcactatttatcagagtgtcctttttatttggca
ctgtcagatcgtgtactagccatgaaacgtattcagcagctgtttgctgaatatggtatg
gaaatgccagagttattagaggctcgttctgcacgctatttaaatggttcgatagacttg
gtttattttgatggacagcgttatcacattgctgactataagagtaactacttgggtgaa
aaccttgctgattacagtgtagaaagtattgcacaaagtatgtctttagccagctattgg
ctacaagcaggcttgtatttggttgcgttacatcgttatttaaaagtcaaaatgcagaat
tatgatattgaacaacacttaggtggggcgacttatctttacttgcgcggtatgaatggc
gaagctgagcagggttattattattggcagcccagtacagaatttgttctacgactcgat
gctattttagggtactttgctgaggataaaattgcataa

DBGET integrated database retrieval system