KEGG   Acinetobacter baumannii ZW85-1: P795_3225Help
Entry
P795_3225         CDS       T02954                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00970  Aminoacyl-tRNA biosynthesis
abaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    P795_3225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abaz03029]
    P795_3225
Enzymes [BR:abaz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     P795_3225
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     P795_3225
Mitochondrial biogenesis [BR:abaz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    P795_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHB90370
Position
complement(690703..692181)
Genome map
AA seq 492 aa AA seqDB search
MTDLHRLSIRELAEGLSQAKFSSRELTEHYLKRIAKIDPQVKSYVTVTPEQALREADAAD
AALKAGNATALTGIPLAHKDIFCTKGIKTTAGSKMLDNFISPYDATVVEKTRAAGLVTLG
KVNMDEFAMGSTSESSYVGATSNPWALDHVPGGSSGGSAAAVAADLAPFATGTDTGGSIR
QPASFCGLTGLKPTYGRVSRFGIIAYASSLDQAGPMARSAEDCAYLMNVIAGHDAKDSTS
VKKEVDDYVANLNNTSVKGLRIGIPKQYFNVAGLDADVKARVEESLKKLEAMGATLVEID
LNMTEAYVPTYYLIAPAEASSNLSRYDGVRYGYRCENPADLMDLYKRSRSEGFGPEVQRR
ILIGTYALSAGYYDAYYVKAQKVRRLIQQDFLKAFENVDVIAAPAAPTTAYKIGASLDPV
EMYLGDIYTIAVNLAGLPAINAPVGFDKDNLPVGLQLIGNYWSESQLLSIVHQYQQNTDW
HTKRAAIAEENA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttacatcgcttatcaattcgcgaacttgctgaaggcctaagccaagcgaag
ttttcatctcgcgaattgactgaacattatttaaaacgtattgctaaaattgacccgcaa
gttaagagctatgtgacggttactccagaacaggcacttcgcgaagccgatgctgccgat
gccgcattaaaagctggcaatgcaactgctttaacgggtattcctcttgcccacaaagac
atcttttgtaccaaaggtattaaaaccactgctggttcaaaaatgctcgataacttcatt
tcaccttacgatgcaaccgttgttgaaaaaactagagcagctggtctggttactttaggt
aaagtgaacatggatgagtttgcgatgggctcaacttctgagagttcatatgtcggtgca
acgagcaacccttgggcacttgaccatgttcctggcggttcatctggtggttctgctgca
gctgtagcagctgatttagcaccatttgctacaggtaccgatacaggtggctcaattcgc
caacctgcttctttctgtggtttaacaggcttaaaaccaacttatggtcgtgtatctcgt
ttcgggatcattgcttacgcatcatcattagaccaagcaggtccaatggcacgctctgct
gaagactgtgcttacctaatgaatgtaattgcaggtcacgatgctaaagactcaacttcg
gttaaaaaagaagtcgatgattacgttgcaaacctaaataacacatctgtaaaaggctta
cgcattggtattcctaaacaatactttaacgttgcaggtttagatgcggacgtaaaagca
cgtgttgaagagtctttgaaaaagcttgaagcaatgggcgcaacgcttgttgagatcgac
ctaaacatgactgaagcgtatgtaccaacgtattacctcatcgcgccagcggaagcatct
tctaacttgtcacgttatgacggtgttcgctacggttaccgctgtgaaaacccagctgac
ttgatggatctttacaaacgttcacgttcagaaggtttcggtccggaagttcaacgccgt
attttaattggtacatacgcgctttctgcgggttattacgatgcttactatgtaaaagca
caaaaagtacgtcgtttaattcaacaagacttcttaaaagcttttgaaaatgtagatgta
attgcagcacctgctgcaccaacaactgcctacaaaatcggtgcatctttagaccctgtt
gaaatgtacttaggcgatatctataccatcgcagtgaacttagcgggcttgccagcgatt
aatgctcctgttggttttgataaagacaacttaccagtaggtttacagttaatcggtaat
tactggtcagaatcacaattgttgtcgattgttcaccaataccaacaaaacactgactgg
cacaccaaacgtgcggcaattgctgaggagaatgcataa

DBGET integrated database retrieval system