KEGG   Acinetobacter baumannii ZW85-1: P795_3230Help
Entry
P795_3230         CDS       T02954                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00970  Aminoacyl-tRNA biosynthesis
abaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    P795_3230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abaz03029]
    P795_3230
Enzymes [BR:abaz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     P795_3230
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     P795_3230
Mitochondrial biogenesis [BR:abaz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    P795_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AHB90371
Position
complement(692235..692549)
Genome map
AA seq 104 aa AA seqDB search
MSTSDAQHSADLNAQTVSAIANLARLSLNDTQSAEYAQSLNKILGMMETLKGIDTEGVEP
LKSPFDNPQPLRADVVTESNHRDEYQAVAPATQDGLYLVPRVIE
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatcggatgcacagcattcagcagatttaaatgcacaaacagtttcagcaatc
gccaatcttgctcgattgtcgctcaatgatacgcaatctgctgaatatgctcaaagtcta
aataaaattttaggcatgatggaaaccttaaaaggcattgatacggaaggcgtagaacct
ttaaagagtccttttgacaatcctcaacctttacgtgctgatgtggtaactgaaagcaat
catcgggacgaataccaagcagttgcacctgcaactcaagatggtttgtatcttgttcct
cgcgtgattgaataa

DBGET integrated database retrieval system