KEGG   Acinetobacter baumannii ZW85-1: P795_5410Help
Entry
P795_5410         CDS       T02954                                 

Definition
(GenBank) histidine permease ABC transporter ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    P795_5410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abaz02000]
    P795_5410
Enzymes [BR:abaz01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     P795_5410
Transporters [BR:abaz02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    P795_5410
   Histidine transporter
    P795_5410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_23 Mg_chelatase AAA_16 RsgA_GTPase AAA_22 PRK SUKH-4 G-alpha NB-ARC NACHT AAA_18 AAA_33 AAA_28
Motif
Other DBs
NCBI-ProteinID: AHB90807
Position
1195472..1196248
Genome map
AA seq 258 aa AA seqDB search
MEQVAKLVIRDLHKTFGDHEVLKGISLDANAGDVISIIGSSGSGKSTLLRCINFLEQPSN
GTIKLNGEKLHTVFDKKGNLKVVEPKQLQKMRTQLMMVFQHFNLWSHMTVLENVIEGPIH
VLGIKRAEAEERARKYLRKVGLPESVESKYPAFLSGGQQQRVAIARALAMEPEVMLFDEP
TSALDPELVGEVLKVMQGLAEEGRTMIVVTHEMGFARHVSNQVIFLHQGKIEEQGHPDEV
LNNPKSERLKQFLTGSLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggttgcaaaactagtgattcgcgatttacataagacattcggcgatcatgag
gtacttaaaggaatatcacttgatgcaaatgccggtgatgtaattagtattattggttca
tctggttcaggtaaaagtaccttgctgcgttgtatcaactttttagaacaaccgagcaat
ggcacgattaagctcaatggtgaaaaattacacacggtctttgataaaaaaggcaattta
aaagtggttgaaccaaagcaactacaaaaaatgcgtacccagctgatgatggtatttcag
cactttaatttatggtctcacatgacagtgctggaaaatgtcattgaagggcccattcac
gtacttgggataaaacgtgctgaagctgaagagcgtgcacggaaatatctacgcaaagtt
ggattacctgaaagtgttgaaagtaaatatccggcatttttatctggtggtcagcaacaa
cgcgtagcgattgcccgtgctttggctatggaaccggaagtgatgttatttgatgaacca
accagtgcgcttgacccagagttggtaggtgaagtactaaaagtaatgcagggcttggct
gaagaaggacgtaccatgattgtagtgacacatgaaatgggcttcgcgcgtcatgtatct
aatcaggtgatttttttgcatcaagggaaaattgaggaacagggccatcctgatgaagtg
ctcaataacccgaaaagtgaacgtttaaagcaatttttgacgggcagtttaaaataa

DBGET integrated database retrieval system