KEGG   Acinetobacter baumannii ZW85-1: P795_6685Help
Entry
P795_6685         CDS       T02954                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase FadI
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00071  Fatty acid degradation
abaz00072  Synthesis and degradation of ketone bodies
abaz00280  Valine, leucine and isoleucine degradation
abaz00310  Lysine degradation
abaz00362  Benzoate degradation
abaz00380  Tryptophan metabolism
abaz00620  Pyruvate metabolism
abaz00630  Glyoxylate and dicarboxylate metabolism
abaz00640  Propanoate metabolism
abaz00650  Butanoate metabolism
abaz00900  Terpenoid backbone biosynthesis
abaz01100  Metabolic pathways
abaz01110  Biosynthesis of secondary metabolites
abaz01120  Microbial metabolism in diverse environments
abaz01130  Biosynthesis of antibiotics
abaz01200  Carbon metabolism
abaz01212  Fatty acid metabolism
abaz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P795_6685
   00630 Glyoxylate and dicarboxylate metabolism
    P795_6685
   00640 Propanoate metabolism
    P795_6685
   00650 Butanoate metabolism
    P795_6685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    P795_6685
   00072 Synthesis and degradation of ketone bodies
    P795_6685
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    P795_6685
   00310 Lysine degradation
    P795_6685
   00380 Tryptophan metabolism
    P795_6685
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P795_6685
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    P795_6685
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P795_6685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abaz04147]
    P795_6685
Enzymes [BR:abaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     P795_6685
Exosome [BR:abaz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P795_6685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: AHB91062
Position
complement(1473068..1474636)
Genome map
AA seq 522 aa AA seqDB search
MSKTTQENPAVENSAQEKVSNTSKSASNTAKRNSTTPKAATNTPKTTRTRSTTAPARSPR
SKSAASATPSTSSNVAAAPKATKTKTSVQQDKTMSQNTVRRVAILGGNRIPFARSNTAYF
KASNSDMLTAALNGLVERFNLQGKRIGEVVAGAVLKHSRDFNMTREVVLSTDLAPETPAY
DIQIACGTGLQAAFVVANKIALGQIDVGIAGGVDTTSDAPIAVGDGLRKVLLELNVAKTG
KDRLKALTKIDFKKLLDAPSNGEPRTGLSMGEHQAITALEWGITREAQDELAASSHQKLA
AAYERGFFDDLMTPFLGLNRDNNLRPDSTVEKLAKLKPVFGKGETATMTAGNSTPLTDGA
SVVLLASEEWAKENGHEVLAYLSFSETAAVDFIGKNGPKEGLLMAPAYAVPRMLKRANLK
LQDFDFYEIHEAFASQVLSTLKAWEDEKFCKERLGLDAPLGSIDRSKLNVNGSSLGAGHP
FAATGGRILATAAKLINEKGSGRALISICTAGGEGVVAIVEK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtcgagaattctgctcaggaaaaagtgtca
aatacatcaaagtcggcttctaacacggctaagcgtaacagcactactcctaaagcagca
actaatacaccaaaaacgacacgtactcgttcaacgactgcacctgcacgtagccctcgt
agtaagagcgctgcttcagcaaccccgtctacatcttcaaatgtagctgcagcaccaaaa
gcaacaaaaaccaaaacttctgttcaacaggataaaaccatgagtcaaaacactgttcgc
cgcgttgcaatccttggtggcaaccgtattccatttgcacgttcaaatactgcctacttt
aaagcgtctaattctgacatgctgacagcagcattgaatggtttggttgagcgctttaac
ttacaaggtaaacgtattggcgaagttgttgcgggcgctgttttaaaacatagccgtgac
ttcaacatgactcgtgaagttgtattgagcacagatcttgctcctgaaactcctgcttac
gacatccaaattgcatgtggtacaggtttacaagcagcatttgttgttgctaacaaaatt
gcgcttggtcaaatcgacgtaggtattgcaggtggcgtagatacaacttctgacgcaccg
attgctgtaggtgatggtttacgtaaagttttacttgagcttaatgttgctaaaacaggt
aaagaccgtcttaaagctctaacaaagattgattttaaaaagcttcttgatgcaccaagc
aatggtgaaccacgtactggcctttcaatgggtgagcaccaagcaatcactgcattagaa
tggggtatcactcgtgaagcacaagacgagctagctgcaagcagccatcaaaaacttgct
gctgcttatgagcgtggtttctttgatgacttaatgactccattcttaggtcttaaccgt
gacaacaacttacgtcctgacagtacagttgaaaaacttgctaagttaaaaccagttttc
ggtaaaggcgaaactgcaacaatgacagcgggtaactcaactccgttgactgatggtgct
tctgtggtattgcttgcttctgaagaatgggcaaaagaaaacggacatgaagttttagct
tatctttctttctctgaaacagcagctgttgacttcattggcaagaacggtcctaaagaa
ggcttattgatggctcctgcttatgcagtacctcgtatgcttaagcgtgctaaccttaag
cttcaagacttcgatttctacgaaatccatgaagcatttgcatctcaagtactctctacc
ttaaaagcttgggaagatgaaaaattctgtaaagaacgtcttggcttagatgcaccattg
ggttcaattgaccgctctaaactgaacgtaaatggttcatctttaggtgcgggccaccca
tttgctgccactggtggtcgtatcttggctactgcagctaaattaattaatgaaaaaggt
tcaggccgtgcattaatctcgatctgtacagcaggtggtgaaggtgtggttgcgattgta
gaaaaataa

DBGET integrated database retrieval system