KEGG   Acinetobacter baumannii ZW85-1: P795_9265Help
Entry
P795_9265         CDS       T02954                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
abaz  Acinetobacter baumannii ZW85-1
Pathway
abaz00620  Pyruvate metabolism
abaz00630  Glyoxylate and dicarboxylate metabolism
abaz01100  Metabolic pathways
abaz01110  Biosynthesis of secondary metabolites
abaz01120  Microbial metabolism in diverse environments
abaz01200  Carbon metabolism
Module
abaz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    P795_9265
   00630 Glyoxylate and dicarboxylate metabolism
    P795_9265
Enzymes [BR:abaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     P795_9265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AHB91578
Position
complement(2025450..2027615)
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEIFPLV
QGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgaccttagtccaaagaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcaccgcaacaataaatttgaattaggtgcttacaaagca
tttttaactgaaattggttatttattaccagaagttgaagacttccaaattactactgaa
aacgtagatgaagaaattgcattgttagcagggccacaattagtagtgcctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcgcgttggggttctttatatgatgcactttac
ggttttgatgtaatttcagaagaaggcggtgcagaaaaaggaaaaggatataaccctgta
cgtggtgcgaaagttattgagtttgctaaaaacttcttaaatgaaattttcccgcttgtg
caaggctcacatgctgatgcaactaaatatgcaatcgagcagaataaactcgttgtgact
ttaaaagatggtactaaaactggcttagctcatgaagctcaatttgtgggcttcaatggt
gaagaagcgaacccttcagaagttgttcttttgagtaatggcttacatgtcattattgaa
attgatgcgaatagcccaattggccaaactgatttagcgggtgttaaagatctaacactt
gaagctgcggttacaacaattcaggatcttgaagactctgtagcagctgttgatgcagaa
gaaaaagttgaaggttatcgtaactggttaggtttgatgaagggtactcttcaagaatct
atcgaaaaaaatggtaaaacaattgtccgcgctttgaataaagaccgtgaaattaaaaat
ttgatcggtggcacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
catttaatgacgaatccagccattttagttgatggtgaagaaattttcgaaggtattatg
gatgcgttggtaacgccattgttatcaattgctgacatccgtagtgaaaacgaaaataaa
aactctcgtaaagggtctatgtatattgttaaaccaaaaatgcatggtcctgaagaagtt
gcttttgctgttgagttatttgagcgtgctgagcaagccttaggattaccagcgaagtct
ttaaaaatcggtattatggatgaagaacgccgtacatctgtaaacttgaaaaactgtatt
gctgccgctaaagatcgcacaatctttattaacactgggttcatggaccgtactggtgat
gaaatccatacttctatggaagctgctccagttgttcgtaaagaagcggttaaaacacaa
aaatggattgctgcatacgaaaaccgtaacgttgcaattggtttgaaatgtggtttacaa
ggtaaagctcaaattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgctcatccaaatgctggtgcttcatgtgcttgggttccatcaccaact
ggtgctgtacttcatgcgatgcattaccatcaagtaaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcaactgat
acaaactggtcagcagaagaaattaataacgaacttgaaaataactgccaaggtatttta
ggttacgttgttcgttgggtggacttaggtgtaggttgttcaaaagttcctgatattaac
aatgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacatgttgccaac
tggttacgtcacggtatcgtgactcgtgaacaagttgaagaagtgcttaaacgcatggca
aaaattgttgatgaacaaaatgcgaatgatccattgtataaaccaatggcagctaacttt
gaaactaatattgctttccaagcagcttcagaccttatctttaaaggttgtgaacagcct
tctggttatactgagccattactacatgcggctcgtttaaaattaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system