KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000317Help
Entry
ABBFA_000317      CDS       T00795                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
abb  Acinetobacter baumannii AB307-0294
Brite
KEGG Orthology (KO) [BR:abb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abb03009]
    ABBFA_000317
Enzymes [BR:abb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ABBFA_000317
Ribosome biogenesis [BR:abb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ABBFA_000317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_32 Ubie_methyltran Methyltransf_9 PCMT TPMT MTS Methyltransf_12 Methyltransf_4 Methyltransf_8 Methyltransf_18 NodS DREV PrmA tRNA_U5-meth_tr Methyltransf_29 Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: ACJ56066
Position
339865..340671
Genome map
AA seq 268 aa AA seqDB search
MCPVCRQRLELVSKTWRCEQGHSYDIAKQGYVNLHVVQHKHSKNPGDTPESVDARRAFLQ
GGYYQPLQQAVVHLLKDLKAKMVLDIGCGEGYYTSAMQQVVEQCIGVDIAKNAVQRAAKL
NDKVTWVVGTGATLPVIDQSLDVCTSLFSPIPQMEILRVLKDDGYLIVVTPATDHLYAMR
EALFEQVNPHTPQKFVEQLQDLFELKEQQVIDAPLVLDQQALKNLIAMTPYAYKASPERR
MQLEQKAHLQVTASFQIYLFQKRNKKAI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtgccctgtgtgtcgtcaacgacttgagctggtaagcaaaacatggcgatgtgaacag
ggtcatagctatgacattgcaaagcaaggttatgtgaacttacatgttgtacagcacaaa
catagtaaaaatccgggagatactcctgagtctgtagatgcgcgccgtgcttttttacaa
ggtggctattatcaacctttacagcaagcagtagttcatttgctgaaagatcttaaagct
aaaatggtacttgatattggctgtggcgagggctattacaccagcgcaatgcaacaggtc
gttgaacagtgtataggtgtagatattgcaaaaaatgcagtacaacgcgcagcaaagtta
aatgacaaagtgacatgggtggttggtacaggagcaactttacctgtcatcgatcaaagc
ctggatgtgtgtacgagtctttttagcccgattccccaaatggaaattctgcgtgtttta
aaagatgatggttatttaattgttgtgactccggcaaccgatcatttgtatgcgatgcgt
gaggcattgtttgaacaggttaatcctcacacaccacagaaatttgttgaacaactacaa
gatttatttgagttgaaagaacagcaagttattgatgctccgttagtacttgatcagcaa
gctttaaaaaatcttattgctatgactccctatgcttataaggcatctccagaacgtcgt
atgcaactagaacagaaagcacacttacaagtgaccgcatcttttcaaatttatcttttt
caaaagcgtaataaaaaagccatctaa

DBGET integrated database retrieval system