KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000592Help
Entry
ABBFA_000592      CDS       T00795                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00260  Glycine, serine and threonine metabolism
abb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01130  Biosynthesis of antibiotics
abb01230  Biosynthesis of amino acids
Module
abb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABBFA_000592 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABBFA_000592 (trpA)
Enzymes [BR:abb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABBFA_000592 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACJ56734
UniProt: B7GWQ5
Position
621939..622742
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLNPVEVIGYEKFVSYAKQ
CGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLK
GVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKAMGSVADAVIVGSAFVKSF
ATLAADEAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaaaagctgcagtcccaacaacgtaaagcgcttgta
tcttatgtcatggcgggtgatccacagccacaagtaacggtgccgttacttcataaaatg
gttgcggcaggagtagacgtcattgagcttggtttaccattttcagacccgatggctgat
ggtccggtaattgcacttgctgctgaacgcgcacttgcggctgggacgaacaccttagat
gcgctgaacatggtaaaagagtttcgtgagcaggatcaggaaacacctgtagttttaatg
ggttatcttaatcctgttgaagtgattggttacgagaagtttgtttcttatgcgaaacaa
tgtggtgtagatggcttattacttgtggacttaccaccggaagagtcaaaagaatttggt
gcaatcttgaaacaacatgatatggatcagattttcttacttgcaccaacttcaactgat
caacgtattcaacacgtagcgaatcaggcaagcgggtttatctactatgtttcactcaaa
ggtgtaacaggtgcagcgactttggatacttctgaagcggctgcacgtattgaaaaaatc
aaaggtatgactaacgttccagttggcgttggtttcggaattagtgatgctgcttcagcg
aaagcgatgggtagtgttgcagatgccgtgattgtaggtagtgctttcgttaaatctttt
gcaacgttggcagctgatgaagctgttgaacagacggtgaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system