KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000607Help
Entry
ABBFA_000607      CDS       T00795                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00071  Fatty acid degradation
abb00280  Valine, leucine and isoleucine degradation
abb00281  Geraniol degradation
abb00310  Lysine degradation
abb00362  Benzoate degradation
abb00380  Tryptophan metabolism
abb00410  beta-Alanine metabolism
abb00640  Propanoate metabolism
abb00650  Butanoate metabolism
abb00903  Limonene and pinene degradation
abb00930  Caprolactam degradation
abb01040  Biosynthesis of unsaturated fatty acids
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
abb01200  Carbon metabolism
abb01212  Fatty acid metabolism
Module
abb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABBFA_000607
   00650 Butanoate metabolism
    ABBFA_000607
  Lipid metabolism
   00071 Fatty acid degradation
    ABBFA_000607
   01040 Biosynthesis of unsaturated fatty acids
    ABBFA_000607
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABBFA_000607
   00310 Lysine degradation
    ABBFA_000607
   00380 Tryptophan metabolism
    ABBFA_000607
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABBFA_000607
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABBFA_000607
   00281 Geraniol degradation
    ABBFA_000607
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABBFA_000607
   00930 Caprolactam degradation
    ABBFA_000607
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABBFA_000607
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABBFA_000607
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABBFA_000607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C DUF5333 Methyltransf_31 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACJ58613
Position
complement(637241..639226)
Genome map
AA seq 661 aa AA seqDB search
MLFFAQQKKTFFAGGDLDELIQVQPEHATDFFNMVEKLKGHLRTIETLGVPVVAALNGTA
LGGGWEIALSCHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGK
QFGVDKAKSLGLIHDTAENEQELLDKAIAWIKANPKSQQPFDVKGYKIPGGDPKTPAVAQ
VLAIAPAMLKDKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLATGQISKNMIG
TFWHGLNAIKSGASRPADIAKWQATKVGVLGAGMMGAGIAYATAIKGIPVILKDVSVENA
EKGKAYSQKLLDKRVSQGRMTAEKRDQILSLITATASAEDLQGCDLIIEAVFENQELKAK
VTQEAEQYLAPNGVMASNTSTLPITGLAQASKNDKAFIGLHFFSPVDKMQLVEIIKGKNT
SAETLAKAYDFVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAEGVHPARIEMAALK
AGMPVGPLAIQDEVSLTLTEHVASETRKALQAEGKELPKTPVDEVIHTMIHELNRKGKAA
GAGFYDYPENGKKHLWEGLNRWQKDHDISEQDMIDRILFVQALDTLRCYEEGVLESVIDA
NVGSIFGIGYAPWTGGAIQFLNQYGIDKAQKRAEELAAKYGERFTPPTLLKTKAEQKQNI
Q
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
gtgttatttttcgctcagcaaaaaaaaactttctttgctggtggtgatttagatgaactg
attcaagttcaacctgagcatgcaactgactttttcaatatggttgagaagttaaaaggt
catctaagaacgattgaaacactaggagttccagttgttgcagcattaaatggcacggca
ctgggcggaggatgggaaatcgcattaagttgccatcaccgtattgcaatcaatgacccg
aaaagcaaatttggcctaccagaagttaccttaggtttactaccgggcggcggtggtatt
gtacgtatggtccgtctgcttggtcttcaaaatgcatttccatttttaatggaaggtaag
cagttcggtgtcgataaagcaaaatctttaggcttaattcatgacacagctgaaaatgaa
caagaacttttagataaagcgattgcttggatcaaagccaatccaaaatctcaacagcct
tttgatgtgaagggttataaaattccgggtggcgatccaaaaactccggcagttgcacaa
gttcttgccattgcgccagccatgttaaaagacaaaaccaagggctgctatcctgctcct
gaagcgattatggctgccgcagttgaaggtgctcaagttgatgtcgataccgccttgcgc
atcgagtctcgctactttactcaactagcaacaggccaaatttctaaaaatatgattggc
actttctggcatggtctaaatgcaattaagtcgggtgctagccgtcctgccgatattgca
aaatggcaagccactaaagtgggcgtgttgggtgcgggcatgatgggtgccggtattgcc
tacgccactgcaattaaaggcattcctgttatccttaaagatgtatctgttgaaaatgct
gaaaaaggcaaagcttattctcagaaattgctagataaacgtgtttcacaaggccgcatg
acggcagaaaaacgtgatcagattttatcgctcattacggctacagcttctgctgaagac
ttacaaggttgtgacctgattattgaagccgtatttgaaaaccaagaacttaaagcgaaa
gtcactcaagaagctgaacaatacttagcgcctaatggtgtaatggcatcaaatacatca
actctaccgattacaggtttagcgcaagcaagcaagaatgataaagcatttattggcctg
catttctttagccctgtcgacaaaatgcaattggttgagattattaaaggtaaaaacacc
tccgcagagacacttgccaaagcttacgactttgtacaacaaattggaaaaacaccgatt
gttgttaatgatagccgtggtttctttaccagtcgtgtgtttggtacttttattcaagaa
ggtatgcgcttacttgcagaaggcgtccatccagcgcgtattgaaatggcagcactgaaa
gctggcatgccggtgggaccacttgcgattcaagatgaagtgtctttaactttaacggag
catgttgcaagtgaaacacgtaaagcgctacaagccgaaggcaaagagctaccgaaaaca
ccagtagatgaagtgattcataccatgattcatgaattaaaccgtaaaggtaaagctgct
ggcgcaggtttctatgactatcctgaaaatggtaaaaaacacttatgggaaggcttaaac
cgttggcaaaaagatcatgatatttctgagcaagatatgattgaccgtattttgtttgta
caagccttagataccttacgttgttatgaagaaggggtattagagtcagtgattgatgcc
aatgtcggttctatttttggaattggttatgctccgtggacgggaggagcaattcaattc
ttaaatcaatatgggattgataaagcacaaaaacgtgccgaagagttggctgccaaatat
ggtgagcgcttcacgcccccaacgttactaaaaactaaagctgagcagaagcaaaatatt
caataa

DBGET integrated database retrieval system