KEGG   Acinetobacter baumannii AB307-0294: ABBFA_000766Help
Entry
ABBFA_000766      CDS       T00795                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain(SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00020  Citrate cycle (TCA cycle)
abb00640  Propanoate metabolism
abb00660  C5-Branched dibasic acid metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
abb01200  Carbon metabolism
Module
abb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABBFA_000766
   00640 Propanoate metabolism
    ABBFA_000766
   00660 C5-Branched dibasic acid metabolism
    ABBFA_000766
Enzymes [BR:abb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ABBFA_000766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACJ57268
UniProt: B7GXK7
Position
802250..803416
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVMKAQVHAGGRGKAGGV
KVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYPVERELYLGAVVDRSSR
RITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
IMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSNALYRLPKVAALRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
LLDESGLKLISANGLSDAAEKVVAAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagctaaagcgttattgaaagaatatggtatgccggtacaa
gaaggtatcttggcaaccaatgcagacgaagcagttgctgcatttgaacagcttggtggt
aaattcgctgtaatgaaggcgcaagttcatgctggtggtcgtggtaaggctggtggcgtt
aaagttgcaaaatctaaagaagatgttatcgaatttgcaaacaatatcattggtactcgt
cttgtaacgtatcaaacagatgcaaatggtcaaccagtaaacagcatcattgttgctgaa
gacgtatatccagttgagcgtgagctttacttgggcgcggttgtagaccgttctagccgt
cgtattactttcatggcttctacagaaggtggtgtagaaatcgagaaagttgcggaagaa
actccagaaaaaattatcaaagttgaagttgatccattagttggtttacaaccattccaa
gcacgtgaagttgcgtttgctttaggtttgaaagacaagcaaatcggtcaattcgtgaaa
atcatgacagctgcttaccaagcatttgttgaaaatgatttcgctttatttgaaattaac
ccactttcagttcgtgaaaatggcgaaattttatgtgtagacgcgaaagtaggtatcgac
tctaacgcgctttaccgtttacctaaagttgctgctttacgtgacaaatctcaagagaat
gagcgtgaattaaaagcatctgaatttgatcttaactatgttgctttagaaggtaacatt
ggctgtatggttaacggtgctggtcttgcaatggcaactatggacatcattaaactttat
ggtggtcagcctgcaaacttccttgacgttggtggcggtgcaactaaagagcgtgtaatc
gaagcgttcaaaatcattcttgctgatacgtctgtacaaggtgttttaatcaacatcttc
ggtggtatcgtacgttgtgacatgattgctgaagcaattattgcagcggttcaagaagta
aacgtaactgttccagttgttgttcgtttagaaggtaacaacgctgagttaggtgcgaaa
ttacttgatgaatctggtttgaaattaatttctgcgaacggtttgtctgatgccgcagaa
aaagttgtagctgcagttaaagcgtaa

DBGET integrated database retrieval system