KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001764Help
Entry
ABBFA_001764      CDS       T00795                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase(Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00071  Fatty acid degradation
abb00072  Synthesis and degradation of ketone bodies
abb00280  Valine, leucine and isoleucine degradation
abb00310  Lysine degradation
abb00362  Benzoate degradation
abb00380  Tryptophan metabolism
abb00620  Pyruvate metabolism
abb00630  Glyoxylate and dicarboxylate metabolism
abb00640  Propanoate metabolism
abb00650  Butanoate metabolism
abb00900  Terpenoid backbone biosynthesis
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
abb01200  Carbon metabolism
abb01212  Fatty acid metabolism
abb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABBFA_001764
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_001764
   00640 Propanoate metabolism
    ABBFA_001764
   00650 Butanoate metabolism
    ABBFA_001764
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABBFA_001764
   00072 Synthesis and degradation of ketone bodies
    ABBFA_001764
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABBFA_001764
   00310 Lysine degradation
    ABBFA_001764
   00380 Tryptophan metabolism
    ABBFA_001764
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABBFA_001764
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABBFA_001764
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABBFA_001764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abb04147]
    ABBFA_001764
Enzymes [BR:abb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABBFA_001764
Exosome [BR:abb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABBFA_001764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ACJ57002
Position
1894717..1895889
Genome map
AA seq 390 aa AA seqDB search
MSSIVIVSGSRTAMGGFQGSLSSLTAPELGAAVIRESIQRAGVKPEQVDEVIFGCVLSAG
IGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTN
APYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDDFAI
SSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVVDQDEQPLKANLEKIPTLRPAFSKDGTI
TAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPISAIQKVLE
RAGWSVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNVHGGACALGHPIGATGSRIILSL
IYALKRLGKKKGVAALCIGGGEATAVAIEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaattgttatagtttcaggtagccgtactgcaatgggtggttttcagggtagt
ttatcttctctaactgctccagaacttggcgctgctgtcatccgtgaatcgatccaacgt
gcaggtgttaaacctgaacaggtggatgaagtgattttcggttgtgtactcagtgcaggt
attggtcaaggccctgctcgtcaagccatgcgcaaagctggcgtgcctgatcatgtcgga
gctgtgaccattaataaactttgcggctctgcaatgaaagcggtgttaatggcatcagat
acattaaaagcaggtagtgccaatattattgtggctggcggcatggaatctatgaccaat
gcaccttatattttgcctaaagctcgcggtggttatcgtatgggacacggcgaaattaag
gaccatatgtttttagatggcctcgaagatgcagaaacaggtcgtttaatgggttctttt
gctcaagacatggcaaataccaaaggctttacccgtgagcaaatggatgactttgcaatt
tcttcacttaaaaaagcgcaaactgcgattacggaaggttatttcaaagaagagattgtt
cctgttgaagtaaaaacccgtaaaggtgtcgaagttgttgatcaagatgagcaaccatta
aaagctaatcttgagaagatcccaacattgcgtcctgcttttagcaaggacggcacaatt
acagccgctaattcaagctctatttctgatggcgctgctgcattagtacttactactgaa
gaatatgctcaaagccatggtttaaatactttagcaaaaattgtggcaacttcgactcac
tctcagcatccaagcgaattcacaattgctccaattagtgcaattcagaaagtacttgag
cgtgctggttggtctgttgatgaagtagatgcttgggaaattaatgaggcttttgcgatg
gtggcaatggcaccaattcatgagctaggaattgatgaagcaaaagtaaacgtccatggt
ggtgcatgtgcattgggccatccaattggtgctacaggttcaagaattatcctttctctt
atttatgcattaaaacgcttaggtaaaaagaaaggtgtcgctgccctatgtattggtggt
ggtgaagcaacagccgttgcgattgaaatttaa

DBGET integrated database retrieval system