KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001803Help
Entry
ABBFA_001803      CDS       T00795                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00260  Glycine, serine and threonine metabolism
abb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01130  Biosynthesis of antibiotics
abb01230  Biosynthesis of amino acids
Module
abb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABBFA_001803 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABBFA_001803 (trpB)
Enzymes [BR:abb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABBFA_001803 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACJ59338
Position
complement(1938385..1939590)
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREASKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccgaatgaacaaggattttttggtgaatat
ggagggcaatttattcctccacatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttatttcatgcaaaacgcctttcagaacagttaggtggcgcg
caaatttatttaaagcgtgaagacttaaatcataccggtgcccacaaaattaatcactgt
ttaggtgaggctctacttgccaaatatatgggcaaaaagaaagtcattgccgagactggt
gcgggacagcatggcgttgctttagcaacggcttgtgctttagttggtattccatgtgaa
attcacatgggtcaagtagatattgaaaaagaacaccctaatgtggtcaaaatgaaaatt
ttgggtgctcatttagtttcagtaacacgtggtacagcaaccttaaaagatgcagtggat
agcgcttttgaagaatatttaaaagaccctaaaaactttatttatgcaattggttctgtg
gttggaccacatccatttccaaaaatggttcgagattttcaatcgattattggtaatgaa
attaaagagcagacgcatcatcgttttggtaaaaacccagattatgttgtcgcatgtgtt
ggtggcggttcaaatgcaatcggtgcctttacagcatttctaaatgattcggatgtgaaa
ttggttggggttgaaccagcaggacatggtttagaaactcacatgcattcggcaacttta
accttaggtaaaccaagtcaaattcatggtatggcgtgttacgtgcttgaaaatgaagct
ggtgaaccgttacccgtgcattctattgcttcaggattggactatcctggtgttgggcca
cagcatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttggatgcttttatgaccttatctcgtgtagaaggaattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgtcaaagctgccgaaagaaaccatgatc
gtggtgaatctatcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system