KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002442Help
Entry
ABBFA_002442      CDS       T00795                                 

Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00040  Pentose and glucuronate interconversions
abb00053  Ascorbate and aldarate metabolism
abb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABBFA_002442
   00053 Ascorbate and aldarate metabolism
    ABBFA_002442
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     ABBFA_002442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACJ56394
Position
complement(2594987..2596573)
Genome map
AA seq 528 aa AA seqDB search
MSKNNGRQFINGQRVAVNAPALESIAAKDYQPTGYVFSQATLEEVDQAAQAAHNAFLVYS
QTTQEQRASFLEEIARQIEALGANLQEVASLETGLPLARLQGETGRVTGQLRLFAELLRR
GDFYGARIDVALPERKPLPRVDLRQYKVGVGPVAVFGASNFPLAFSTAGGDTVAALAAGC
SVVFKAHSGHMATAELVAEAIEKAIEVCGMPKGTFNMIFGGRIGANLVEHPLIQAAGFTG
SLEGGMALYNLAQSRLQPIPFFAEMSSVNPVVVLPEALHSRGEQIAQDMVASFNMGCGQF
CTKPGLILGIKGPEFDRFITALAENTQKAVPQVMLNEGTLKSYRTGIDALINEAGFEVIA
SGQEPELVSQAKAHLFKADQSVLLSGNPKLQHEVFGPMSIVIAVEDEATLLKGIEALGGQ
LTATIIGDENELSKAGELLDLLTRKAGRILFNGFPTGVEVSDAMVHGGPFPATSDARGTS
VGTGAIERFLRPVCFQNTPQVLLPDALKDSNPLQITRLVNGQLSQAQI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaataacggtcggcagtttattaatggtcaacgcgttgctgtaaatgcgcca
gctttagaaagtatagctgcaaaagactatcaaccaacaggttatgtatttagtcaggca
acacttgaagaagtagatcaggctgctcaagctgcgcataacgcttttttagtttatagc
caaacgactcaagaacaacgtgcatcttttcttgaagaaattgctcgccaaattgaagca
ttgggtgcgaacttgcaagaggtcgcttcacttgaaacaggtttgccacttgctcgtctt
caaggagagacaggccgtgttactggtcagcttcgactgtttgctgaacttttacgccgt
ggcgatttttatggtgctcgtattgatgtggcattaccagaacgtaagcctttaccgcgt
gttgatttgcgtcaatataaagttggggtagggccagttgccgtatttggtgcaagtaat
tttccacttgcattttcaactgcaggcggtgataccgtagctgctttagcagcagggtgt
tcggttgtctttaaagcacactctggccatatggcgactgctgagcttgttgcagaagcc
attgaaaaagccattgaagtttgcggtatgcctaaaggcacattcaatatgatttttggt
ggccgtattggtgcaaacttggtagaacatccactcattcaggcagctggttttacgggt
tctcttgaaggaggaatggcgctttataaccttgcgcagagtcgccttcagccgattcca
ttttttgctgaaatgtcgagtgtgaaccctgtggtggttttacctgaagcacttcattca
cgtggtgaacaaatcgctcaggatatggttgcctcttttaatatgggatgtggtcagttc
tgtacaaaaccgggtctaattttaggtataaaaggccccgagtttgatcgctttattaca
gctttagctgaaaatacgcagaaagctgtgcctcaggttatgttgaatgaaggtacttta
aaaagctatcgaactggtattgatgcattaataaatgaagctggttttgaggtcattgca
tcgggtcaggaacctgagctagtttctcaagcaaaagcccatctgtttaaagcggaccaa
tctgttttattgtcaggtaacccaaaactacaacatgaagttttcggaccgatgtcgatt
gtgattgcggtcgaagatgaagccaccctgttgaagggtattgaagctttaggtggacag
cttacagcaaccattattggtgatgaaaatgaattgtctaaggcaggcgagcttcttgat
ttgttaacccgtaaagctggccggatattgtttaacggtttcccgacaggggtggaggta
tcggatgctatggtacatggtggtcctttccctgcaaccagtgatgcccgtggcacttcg
gtaggtacgggagcaattgagcgcttcttacgcccggtatgcttccaaaatacaccacaa
gttttattacccgatgcattaaaagacagtaatccactacagattactcgtctggtcaat
gggcagttaagtcaggcccaaatttaa

DBGET integrated database retrieval system