KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002602Help
Entry
ABBFA_002602      CDS       T00795                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00630  Glyoxylate and dicarboxylate metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01200  Carbon metabolism
Module
abb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_002602
Enzymes [BR:abb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ABBFA_002602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3944 Nuc_rec_co-act
Motif
Other DBs
NCBI-ProteinID: ACJ59345
Position
complement(2759170..2760774)
Genome map
AA seq 534 aa AA seqDB search
MTTYQTAIDAVRELKAKFGNTWADISPEDAARMQLQNRFKTGLDIAKYTAAIMRRDMAEY
DADSSKYTQSLGCWHGFIAQQKMIANKKYFGTTSKRYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLRQADAKELNDLFRALNKAKEAGDSAKVAEITAQIDNFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACALQIENQVSDAKQCGHQAGKVTVPHEDFIAKI
HALRYAFLEMGVEDGVIVARTDSEGADLTQKIPVVKEPGDIASKYISYLDTQEIDISEAQ
EDEILIKRDGKLHRPTRLASGLYQFREGTQIDRVVLDCITSLQNGADLLWIETPTPNVQE
IAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFRQQAYDRWVAEGKDVSAYDRAKLMSAEYD
NTELAAEADEKIRTFQADAAREAGVFHHLITLPTYHTAALSTHELAQGYFGDQGMLAYVA
GVQRKEIRGGIACVKHQAMAGSDIGDDHKEIFAGENALKAGDDAKNTMNQFSAH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgactacatatcaaacagcgattgatgcagtacgtgaattaaaagcaaaattcggcaac
acttgggcagacattagcccagaagatgctgctcgtatgcaacttcaaaaccgtttcaaa
acaggtttagatattgctaagtatacagctgcgattatgcgtcgtgatatggctgaatac
gatgctgattcaagcaaatatactcaatcattaggttgctggcatggtttcatcgctcaa
caaaaaatgattgctaacaaaaagtatttcggtacgacaagcaaacgttatatctacctt
tctggttggatggttgctgctcttcgttcagaatttggtccacttcctgaccaatctatg
cacgagaaaacttcagtacctgctttgatcgaagaaatctacactttcttacgtcaagct
gatgcaaaagaattaaatgacttgttccgtgctttaaataaagcaaaagaagctggtgat
tctgcgaaagtagctgaaatcacagctcaaattgacaacttcgaaactcatgttgtgcca
attattgcagacatcgatgctggtttcggtaacgaagaagcaacttacttacttgctaag
aaaatgatcgaagctggtgcttgtgcacttcaaatcgaaaaccaagtatctgatgcaaaa
caatgtggtcaccaagctggtaaagtaactgttccacacgaagacttcatcgctaagatc
catgcacttcgttatgcattcttagaaatgggtgttgaagacggtgttatcgttgctcgt
actgactctgaaggcgctgacttaactcagaagatccctgtagttaaagagccgggtgat
atcgcatctaaatatattagctacttagatactcaagaaattgatatctcagaagctcaa
gaagatgagatcttaattaaacgtgatggtaaattacatcgtccaactcgtttagcttct
ggtttataccaatttcgtgaaggcactcagattgaccgtgttgtacttgactgtatcact
agccttcaaaacggtgctgacttactttggatcgaaactccgactccaaacgtacaagaa
attgcacacatggttaaccgtgtaaaagaagtagttccgaatgcgaagcttgtttataac
aacagcccatcattcaactggactttaaacttccgtcaacaagcgtacgatcgttgggtt
gcagaaggtaaagatgtatctgcttacgaccgtgctaaattaatgagcgctgagtacgac
aatactgaattagctgctgaagctgatgaaaaaatccgtactttccaagcagatgctgcg
cgtgaagctggtgtgttccatcacttgatcacacttcctacataccacactgctgctctt
tctactcatgaattagcacaaggttacttcggtgaccaaggtatgttagcttatgttgct
ggcgtacaacgtaaagaaatccgtggcggtatcgcatgtgtgaaacaccaagcaatggct
ggttctgacatcggtgatgaccacaaagaaatcttcgctggtgaaaatgcacttaaagct
ggtgacgatgctaaaaacacaatgaaccaattctcagctcactaa

DBGET integrated database retrieval system