KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002685Help
Entry
ABBFA_002685      CDS       T00795                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00020  Citrate cycle (TCA cycle)
abb00620  Pyruvate metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
abb01200  Carbon metabolism
Module
abb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABBFA_002685 (mqo)
   00620 Pyruvate metabolism
    ABBFA_002685 (mqo)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ABBFA_002685 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACJ56713
UniProt: B7GYG6
Position
2853429..2855069
Genome map
AA seq 546 aa AA seqDB search
MKKFLKYLLVLIILILIAGIVFLFRPIASKQVQTAKDEPVVDAVLVGGGIMSATLGTYFT
ELEPNWQIRMYERLDQVAQESSNGFNNAGTGHSGFMEMNYTEEKNGKMEIAKAEKVASQF
EVAKQFWSYQVKQGVLAEPKTFINPVPHIAFVWGDNVKFLEKRYAAMIQSPLFKGMKFTE
DPAVIKQWAPLVMTDRDPTQKVAATRMEVGSDVNYGSITKQLVNHLNQNPNFKLQTSTEV
TGISQNDDKTWTVSFKNLKTGKTDHVKTRFVFIGAGGAAVKLLQLTGLPEAKQYAGFPVG
GEFLITDNPAITAQHTAKVYGRAELGAPPMSVPHIDTRYIDGKKYVLFGPFATYSNKFLK
NGSQLDLLASTNKSNVLLMTTVGLENLDLVKYLVSQVMMSDEDRLNELRKYYPDAKAEDW
RLSQGGQRVQIIKKEPGKPATLQFGTEIFASKDGAVTALLGASPGASTSPYIMLNLLEKA
FPQQTEGKWNQKLHEIVVSYKQDLSKDPVLLDKVRQYTSSTLGLNYTSPFKAANDETAAA
PVAKAN
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttttgaaataccttctggtattaatcattcttattttaattgcaggtatt
gttttcttgtttagaccgattgcgtcaaaacaagtacaaactgcaaaagatgagccagtt
gttgatgctgttcttgttggcggcggtatcatgagtgccactctcggtacttatttcact
gagcttgaaccgaattggcaaattcgtatgtacgaacgtcttgaccaagttgctcaagaa
agttcaaacggctttaacaatgccggaacaggccactctggctttatggaaatgaactat
accgaagagaaaaacggtaagatggaaattgccaaagctgaaaaagttgcttctcagttc
gaagttgctaaacagttctggtcatatcaggtaaaacaaggcgttttagctgaaccaaaa
acattcattaacccagttccacacattgctttcgtttggggcgataacgttaaattctta
gaaaaacgttatgctgccatgattcaaagcccgcttttcaaaggcatgaaatttactgaa
gacccagctgtgattaaacaatgggcgcctttagtcatgaccgatcgtgatccaactcaa
aaagttgcagcgactcgtatggaagttggttctgacgtgaactatggttcaatcactaaa
caattagtgaatcacttaaaccaaaaccctaacttcaaattacagacttcaactgaagtg
actggcatcagccaaaatgatgacaaaacttggacggtgtctttcaaaaatttgaaaact
ggtaaaacagaccacgttaaaacgcgttttgtatttatcggtgcaggtggtgccgcggtt
aaattattgcaacttactggtttaccagaagcgaaacaatatgctggcttccctgtaggt
ggtgagttcttaattactgacaacccggcaattactgctcagcacacagcgaaagtatat
ggtcgtgcggaacttggtgcccctccaatgtctgtaccacatattgatacacgttatatc
gacggtaaaaaatatgtattgtttggaccatttgcaacgtattcaaacaagttcctaaaa
aatggttctcagcttgacttgcttgcatctaccaacaaaagcaatgttttactaatgacc
actgttggcttggaaaaccttgatcttgttaaatacttggtgagccaagtgatgatgtca
gatgaagaccgtctcaatgaacttcgtaaatactacccagatgcgaaagctgaagactgg
cgtttaagccaaggtggtcaacgtgttcagatcatcaaaaaagaaccgggtaaacctgca
acacttcaattcggtacagaaatctttgcgtctaaagatggtgctgtaactgcattgtta
ggtgcgtctccgggtgcttcgacttctccatacatcatgcttaacttgcttgaaaaagct
ttccctcagcaaactgaaggtaagtggaaccagaagcttcatgaaattgtggtttcttat
aaacaagacttaagcaaagaccctgtgttactcgacaaagttcgtcagtacacaagctct
acacttggcttgaactatacatctccgttcaaagctgcaaacgatgaaactgctgctgcc
cctgttgcaaaagcaaactaa

DBGET integrated database retrieval system