KEGG   Acinetobacter baumannii AB307-0294: ABBFA_002952Help
Entry
ABBFA_002952      CDS       T00795                                 

Definition
(GenBank) tRNA(Ile)-lysidine synthase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
abb  Acinetobacter baumannii AB307-0294
Brite
KEGG Orthology (KO) [BR:abb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abb03016]
    ABBFA_002952
Enzymes [BR:abb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     ABBFA_002952
Transfer RNA biogenesis [BR:abb03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ABBFA_002952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS TilS_C CheB_methylest
Motif
Other DBs
NCBI-ProteinID: ACJ57271
Position
complement(3138401..3139675)
Genome map
AA seq 424 aa AA seqDB search
MLLLHLMAQIFPQKIRAIYIDHQLQDQSAEWAEVVATQATILNIPYIIQKVQIANGNLEA
QARQARYQAYQQHLQENEILLLAHHQQDQAETVILRLLSGAGVDGLAAMQAIDYRKDMTI
WRPFLDLTREQIALWTAQLEVKYIDDPMNYDNHYDRVWCREALWPFLTSRFPKMQQALSR
TSYLMQDASEILEEVLKDDWQYSGSADYLDLTKLSELSFARQRQLLSAWMKGQGQYRPAF
EMVERLRAEVIESKSDAQAALHWNQFYYVRYQNILYRLSKQIYFAETLNPVAAELEHSFK
LEEKWQGAAGLFHVEYKKIGLSHSLLNKKLKIIRRQGGEKIHLYGRVGQWPLKKAIQEAH
ILPWLRHTIQILVLDNVMLGVFTPKGFWLAQSPYCEEGGWQPDLISHSCNLVNGEYSYGN
SSEL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctactgctacatttaatggctcaaattttccctcaaaagatccgagcaatttatatt
gatcatcaactgcaagatcaaagtgcagagtgggcggaagtggttgccacacaggcaaca
atattaaatattccttatattattcaaaaagttcagatcgcaaatggcaatctggaagca
caagcacgtcaagcgcgttatcaagcatatcagcaacatttacaagaaaatgaaattctg
ttgcttgctcatcatcaacaagatcaggcagaaacagttattttgcgattattgtcaggt
gcgggagtagatggacttgctgcgatgcaggctattgattaccgtaaagatatgacaatt
tggcgcccctttttggatttaacacgtgagcaaatcgccttatggactgctcagcttgaa
gttaaatatattgacgatccaatgaactatgacaaccattacgatagggtgtggtgtcgt
gaagcactgtggccatttttaacaagccgttttccaaaaatgcagcaagctttgagtcga
accagttatctgatgcaagatgcttctgaaattttagaagaagttcttaaagatgattgg
caatattctggttcagctgactatttagatttaacgaaattatccgagttatcttttgcg
cggcagcgccagttactttctgcgtggatgaaaggccaagggcaatatcgacctgcattt
gaaatggtcgaacggctaagagcagaagttattgagtctaagtcagatgctcaagccgct
ttacattggaaccagttttactatgtccgttatcaaaatatactctataggttgagtaaa
cagatttatttcgctgaaactttaaatccggttgctgctgaactagagcattcatttaaa
ttagaagaaaaatggcagggcgcagctggactgttccatgttgagtataaaaaaattggt
ctaagtcattctttattgaataaaaaattaaaaatcattcgacgtcaaggtggggaaaag
attcacctatatggtcgtgttgggcaatggcctttaaaaaaagcaattcaagaagcacat
attttgccttggcttcgtcatacaattcaaatattagtcttagataatgttatgcttggg
gtttttacaccgaaaggattttggttggctcagtctccatattgtgaggaaggagggtgg
caaccagatttaatttctcattcttgtaatctggtaaatggcgaatatagttatggcaac
agcagtgaattgtaa

DBGET integrated database retrieval system