KEGG   Acinetobacter baumannii ACICU: ACICU_00064Help
Entry
ACICU_00064       CDS       T00710                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00562  Inositol phosphate metabolism
abc00564  Glycerophospholipid metabolism
abc00565  Ether lipid metabolism
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ACICU_00064
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACICU_00064
   00565 Ether lipid metabolism
    ACICU_00064
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACICU_00064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:abc02042]
    ACICU_00064
Enzymes [BR:abc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     ACICU_00064
Bacterial toxins [BR:abc02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   ACICU_00064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: ACC55376
Position
70341..72509
Genome map
AA seq 722 aa AA seqDB search
MNRREFLLNSTKTMFGTAALASFPLSIQKALAIDAKVESGTIQDVKHIVILTQENRSFDN
YFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLDSHLGNAQRVTGTNHSWSD
GQGAWDNGRMSDWVTHKQPQSMGYYKKQEVEYQFALANAFTICDAYHCAMHAGTNPNRKF
IWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPERLQQAGVTWKVYQNMPDNFTDNP
LAGFKQYRRANEQSGQPVSNDTLTCPAYDEKIDVTQPLYKGIANTMPDGGFLGTFKADIA
QGKLPQVSWLVAPATYSEHPGPSSPVQGAWYIQEVLNVLTENPQVWSQTVLLVNFDENDG
FFDHVPSPSAPSKDINGVVYGKTTLTDQQVSFEYFNHPAVATSKSQPETDGRVYGPGVRV
PMYVISPWSRGGWVNSQVFDHTSILQFLEKRFDVQEPNISPYRRAVCGDLTTAFNFKTPN
LLPVAELDGKKTKAEADAIRVAQELLPQVSVPSQQQFPQQEIGIRPSRALPYILHTSAKV
DATQKTVKLMFSNTGKQAAVFHVYNRLDLTAIPRRYMVEAGKQLDDVWNTINGQYDLWVL
GPNGFHRAFKGNLSQANQTQALPEIRVCVEECDANLYLKVRHDGNKTVKLNVKANAYLPN
KTWVIETNSVEKELVWDMSEFGGWYDFTVTLADDATFSRRFAGRIETQEDSISDPYMGYL
ES
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcgcgaatttcttttaaattctacaaaaacaatgtttgggacagctgctcta
gcgagtttcccgctgagtattcaaaaagcgttagcaattgacgccaaagttgaaagtgga
acaattcaagatgttaaacacattgtgattttgactcaggaaaaccgttcatttgataat
tattttggaacactaaaaggtgtacgtggtttcggcgaccgttttaccattcctatgaca
gaaggccgaaaggtttgggaacaatatgacgccaacaaaaagaaagtattgccataccac
ttagatagtcatttaggaaatgctcagcgtgttactggtacaaatcattcatggtcagat
ggtcaaggtgcttgggataatgggcgtatgagtgattgggtaacgcataaacaaccgcag
tcgatgggctactacaaaaaacaagaagttgaatatcaatttgccttagcgaatgctttt
acgatttgtgatgcctaccactgtgccatgcacgcgggaactaacccgaaccgtaaattt
atctggacgggaaccaatggacctacaggtgcaggtgttgcgagtgtggtcaatgaattt
gatgggattggaccatcaacagaaggttatgaatggacgacgtatcctgagcgtttacag
caggctggcgtgacatggaaagtttatcaaaacatgccggataactttactgataaccct
ttagctggtttcaagcaatatcgccgtgcaaatgagcaatctggtcaacctgtcagtaac
gacacactaacgtgtccagcatatgatgaaaagattgatgtgactcaaccactttacaaa
ggtattgccaataccatgccagacggtggttttctaggaacttttaaagctgatattgcg
cagggtaaattaccgcaagtgagttggttagttgctcctgcaacttacagtgaacatccg
gggccatctagtcctgtacaaggcgcttggtatattcaggaagtattaaatgtattaact
gaaaaccctcaagtgtggagtcaaaccgttttattggtgaacttcgatgaaaatgacggt
ttctttgaccatgttccttcaccaagcgcaccttctaaagatataaacggtgttgtatat
ggaaaaactactttaacggaccaacaagtatcttttgaatactttaaccatccagcagta
gcgacttcaaaatctcaacccgaaacagacggacgggtgtatggcccaggtgtacgcgtt
ccaatgtatgtgatttcgccgtggagccgtggaggatgggtaaattctcaagtctttgat
catacttctattttacaattcttagaaaaacgttttgatgtgcaagaacctaacattagc
ccataccgccgtgctgtatgtggtgatttaacaacggcatttaattttaaaacaccgaat
cttttgcctgttgctgaactagatgggaagaaaacaaaagccgaagccgatgcgattcgt
gtcgctcaagaactattgccgcaagtttctgttccgagccagcaacaatttcctcagcag
gaaataggaattcgaccttcgcgtgctttaccttatattttgcacactagtgccaaagtc
gatgccactcaaaaaacggttaagctgatgttctccaatacgggtaaacaggcagccgtt
ttccatgtctataatcgattagatcttacggcaattccacgccgctatatggttgaggcg
ggcaaacagcttgatgacgtgtggaatactatcaatggacagtatgatttatgggtcctt
ggaccaaatggttttcaccgtgcgtttaaaggtaatttaagtcaagctaatcagactcaa
gcattaccggaaattagagtatgtgtagaagaatgtgatgcgaatttatatttaaaagtg
cgtcatgatggtaataagacagtcaagctcaacgtcaaagctaatgcttatctaccaaac
aagacatgggtgatagaaaccaatagtgttgaaaaagaactggtttgggatatgtctgaa
tttggtggttggtatgattttacggtgacattagcggacgatgcgacgtttagtcgccgt
tttgcaggacgtatagaaactcaagaagattcaatttctgatccatatatgggatattta
gagtcttaa

DBGET integrated database retrieval system