KEGG   Acinetobacter baumannii ACICU: ACICU_01300Help
Entry
ACICU_01300       CDS       T00710                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11896  type VI secretion system protein ImpG
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abc02044]
    ACICU_01300
Secretion system [BR:abc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ACICU_01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ACC56612
Position
1400794..1402605
Genome map
AA seq 603 aa AA seqDB search
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI
DKKLTDSYDVFTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRS
FKGVQCEFNTTQEVKLLPIHLSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEK
LPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHT
HHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELLIHFKLNLNDQAVVRNYSELN
IANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQ
EESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSL
NSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGV
KAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGK
TLL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgatagaagagcttttaccgttttatgaaaaacaattacaagaatttggtcaacaatct
cgagaatttgcccaaaaatatccaaaaattgctcagcgcttatctttaaatcaagagcaa
attgatgacccacatattgaacgtctgattcaggctttttcgctgattgctgctcgaatc
gataaaaaactaacagacagttacgatgtttttactcgttctttatttgaggtgatgttc
cctcaatacttacggcattttcctgcgtgttcagttgttagctttgaagatattaataag
attaaacagcttacagaacctcatcttgtacctcatcatacggttttgaaatctcgtagt
ttcaaaggagtacagtgtgagtttaatacaactcaagaggttaaattactacctattcat
ttaagtggtttagattttaaaactacacctagtgcacatatgcacttaaatcaaaatgcg
acgttgagccttaaatttgaaatttttaataatgctcatgcttgtttaactgatgagaag
cttcctatttatttggatgctatctctaattttcctctacaggtccttgatagtattttc
aaaaaaggaaccagttttgcggttaaatatggacaaacaattgtagaattgagcaagaat
ccatttgaattgattggttttgcagaacaagaaagtttattaccgcttgatcaacatacc
catcatgcttatcgtttgttgatggaatacttttgtttcccggaaaagtttagttatctt
aagctcgatttggattttttaaggcgactacctcagcatgtatccgaatttgagctttta
attcatttcaaattaaacttaaatgatcaagccgttgttagaaactattctgagctaaat
attgcaaactttaaattatttactacccccgtaattaatttatttgaaaaatatgctgaa
ccccagaagatagttcacaagcaattagaatatcctttagttacagacgctcaccatcct
gaattttatcaagtatattcaatacttgagatgaatatggtgcgtgaaaaaacaaatcag
gaagaaagctatgttcctgttttgcctttttttgcgatgagccattaccacaatgataca
gctcgctttttttactcagtaaactatcaaaagttacagtccaatttcgttgaaatgggc
tattcgattatttctaaaaatttaaatccattttcaacgcgctcagattttattagcact
aaattattatgttcaaaccgtgatttacctcatgaagcactgggtcagtctaataacgta
ttaaatttaaatgatagtagcttggcgagacgtgccattgttttaaaacgacctacaaag
ccttataagtttgaacaaggccaaagtgaacagtggcgtgtgatctcgcatctttcatta
aatagcttagcacttatgaaaggggatgctgtttctcatgttaaagagctgctggcttta
tataacttaccgcagtcaaaagaaaactatttaattatagaatcaattaaaaaattagaa
ttttctcttacccataaactcgtagatggcaaaccatttccaatgtttgtaagaggagta
aaagctgaattacaaattgattcatccgtatttagagggcatagcttatatatttttagt
cagttattaagtcgtgtttttaatttaaaggttcaaattaatagttttgttgatttggtg
gttaaggattattcatctcagcaggagttataccaatgcagtcagaacgttggtggcaag
actcttctgtaa

DBGET integrated database retrieval system