KEGG   Acinetobacter baumannii ACICU: ACICU_01391Help
Entry
ACICU_01391       CDS       T00710                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00071  Fatty acid degradation
abc00072  Synthesis and degradation of ketone bodies
abc00280  Valine, leucine and isoleucine degradation
abc00310  Lysine degradation
abc00362  Benzoate degradation
abc00380  Tryptophan metabolism
abc00620  Pyruvate metabolism
abc00630  Glyoxylate and dicarboxylate metabolism
abc00640  Propanoate metabolism
abc00650  Butanoate metabolism
abc00900  Terpenoid backbone biosynthesis
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
abc01200  Carbon metabolism
abc01212  Fatty acid metabolism
abc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACICU_01391
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_01391
   00640 Propanoate metabolism
    ACICU_01391
   00650 Butanoate metabolism
    ACICU_01391
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACICU_01391
   00072 Synthesis and degradation of ketone bodies
    ACICU_01391
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACICU_01391
   00310 Lysine degradation
    ACICU_01391
   00380 Tryptophan metabolism
    ACICU_01391
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACICU_01391
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACICU_01391
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACICU_01391
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abc04147]
    ACICU_01391
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACICU_01391
Exosome [BR:abc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACICU_01391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: ACC56703
Position
complement(1495330..1496535)
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFADEITPIEVFQGKKLPPKFVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatttatgatggtttacgtagtccatttggccgtcatgcaggtgaa
cttgcctcaattcgtcctgatgatttggccgcaactgtcattcaaaaactactagaaaaa
actggtgtaccgggcgctgatattgaagatgtgattttaggcgacactaaccaagcgggt
gaagatagccgtaatgtggcacgaaatgcattattacttgcaggtttacctgttactgta
ccgggccagacggtaaaccgcctatgtgctagtggtttaggtgccgtgattgactcagca
cgtgctattacttgtggtgaaggtgaactgtatattgctggtggtgtagaaagtatgtca
cgtgcaccctttgtgatgggtaaagcagaaagcgcttatagccgtgatgcaaaaatttat
gacaccaccattggctctcgctttccaaataaaaaaattattgctcagtacggcggacat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagtcgtgagcaagca
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gccgatgaaattactccaattgaggttttccaaggcaaaaaattgccccctaaattcgtt
tcagaagatgaacatcctcgcccaagttcaactgttgaagcactcacaaagttaaaaccg
ctatttgaaggtggcgtggttacagctggtaatgcctcaggtattaatgatggtgcagca
gcacttttgattggttcagaagcagcaggtcaaaaatatggcttaaaaccaatggcaaaa
atcttatcagcggcggctgcaggtattgagccacgcattatgggtgcaggtccgatcgaa
gccattaaaaaagcggttgcacgtgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaagttttatcttgtttaaaaggtttaaatgttgatttt
aatgatccacgtgtgaacccgaacggtggtgcgattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcttatgtattggtgtaggtcaaggtcttgcgatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system