KEGG   Acinetobacter baumannii ACICU: ACICU_02727Help
Entry
ACICU_02727       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACC58039
Position
complement(2904417..2904950)
Genome map
AA seq 177 aa AA seqDB search
MALKVSIQTSKTVSKWRKYIDGEGNVLAEFKVRGISYKPYQVALERANNQIASKGYDVTK
ASKDDKLYHELLLEAAACHLIEDWKGVVFEEVTENQELIVSEPEYSQENAIKLLNLGDLG
VAIWLFVRQEAENIQKEADAYKDEVVGKSLTSTTGPSSTQKKKRATTTRNKQQLQKP
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaagtaagcattcagactagtaaaacagttagtaaatggcgtaagtatatt
gatggtgaagggaatgtattagctgaatttaaagtacgtggtatctcatataaaccatat
caagtggcccttgagcgtgcaaataatcagattgcatcaaaaggttatgatgtaactaaa
gctagtaaagacgacaagctatatcatgaattgcttcttgaagctgcggcctgccattta
attgaggactggaaaggcgtagtttttgaagaagtaaccgaaaatcaagaactgattgtg
tctgaaccagaatattcgcaggaaaatgcaattaagttgttgaatctaggcgatcttggt
gtggcaatttggttgtttgtgagacaagaggcggaaaatatccaaaaagaagctgatgca
tataaggatgaagtagtgggaaagtcattaacctctacaactggaccaagttcaactcag
aagaagaagcgagcgactacaacaagaaacaaacagcaattgcaaaagccttaa

DBGET integrated database retrieval system