KEGG   Acinetobacter baumannii ACICU: ACICU_02728Help
Entry
ACICU_02728       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2001
Motif
Other DBs
NCBI-ProteinID: ACC58040
Position
complement(2904995..2905924)
Genome map
AA seq 309 aa AA seqDB search
MSSGARQITQIAKETTVGTTPSPFARTTFEFTENGLDATVTKEDSNSITSGRIARSSMIT
GAEYAGELKCEAKYSSLVQDLMAAAAFNNWSSNVLTFGGTLRQTFSVLRGFEDVNDYHVF
RGCHVNTFGIDIPEAGLITMTFGLMALGRTNFSSAPAGTITAADNNPKMSNVSVGDILID
GVSQAGISCLTAFTFNWDNTMQLQRCLGGGIDARAILEMLATGTGSFTAAWSRNTSDMYE
KQFTNKTISLKVPITDTDGNKYEIFIPKAEITAPLPSGGNSDLLNASFEYKVVEVAPTIT
RTPAAVPAP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtggtgcacgtcagataacacaaatcgcgaaggaaaccactgttggtaccaca
ccttcacccttcgcacgtacgacctttgaatttactgaaaatggccttgatgcgacagta
acaaaggaagactctaactcaatcacaagtggccgtattgcacgttcatcaatgattacc
ggtgcagagtatgccggtgaattaaaatgtgaagcgaagtacagttcattagttcaagac
ttaatggctgcagctgcttttaataactggtcgtcaaatgtattaacttttggtggcaca
cttcgtcaaacattttctgttttacgtggctttgaagatgttaatgactaccatgttttc
cgtggatgtcatgtaaacacttttggaattgatattcctgaagctggcttaattacaatg
actttcggccttatggctcttggtcgtacaaacttttcttcagcaccggctggaacaatt
acagcggcagataacaatcctaaaatgtcgaatgtctctgtaggtgacattttaattgac
ggcgtttctcaagctgggatttcatgcttgaccgcttttacatttaattgggataacact
atgcagctacaacgctgtttaggtggtggtattgatgcacgtgcaatcctagaaatgctt
gcaacaggtacaggttcatttaccgcagcttggtcacgcaatacatccgatatgtatgaa
aagcaattcactaacaaaacgatttcattaaaagttccaatcactgatacagatgggaat
aaatatgaaatttttattcctaaagctgaaattactgccccattacctagtggtggtaat
tcagatcttttaaatgcttcattcgaatataaagtcgtagaagtagccccaaccatcact
cgtacaccagcagcagttcctgcgccttaa

DBGET integrated database retrieval system