KEGG   Acinetobacter baumannii ACICU: ACICU_02736Help
Entry
ACICU_02736       CDS       T00710                                 

Definition
(GenBank) Bacterial surface protein containing Ig-like domains
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACC58048
Position
complement(2908893..2909849)
Genome map
AA seq 318 aa AA seqDB search
MTTTVNSDMIIYNQLAQTAYLERLQDNLNVFNQASNGAIVYRNEIIEGDFNKEAFYKVGG
SIKHRDVNSTAKVVPEKIGSGESVGVKVPYKYGPYASTEEAFKRRARTPEEFAMILGYDL
ADALVAGRLQYSLASLKAAISSNPDMVAKGSIAVDGRKALTRGMRKFGDKFGRISLWVMN
SDTYFDIVDDAITNQIYGESEIVIYGGLPGTLGKPVLVTDAVGDDDAFGLQMGAVTVTES
QVPGFRAYDINDEENLAIGMRAEGTFNLDILGYSWDTSKGENPDLTLLGSSANWKKHATS
NKMTAGTLLDLSGTTTTG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacagttaattcagacatgatcatctacaaccaattggctcaaactgcttat
ttagagcgtttgcaagacaatttgaacgtatttaaccaggcctctaatggtgcaattgta
tatcgcaatgagattattgaaggtgatttcaataaagaggcattttacaaagtgggcggt
agcatcaagcatcgtgatgtgaattcaaccgccaaagtagtgcctgagaagattgggtct
ggtgaatctgtaggcgtaaaagtcccatataaatatggtccttatgcttcaaccgaagag
gcattcaaacgccgtgcacgcacacctgaagagtttgccatgattcttggttatgattta
gcagatgcattagttgcaggacgtttacagtacagtttagcctccttaaaagcagctatt
tctagcaacccggatatggttgccaaaggcagtattgctgtagatgggcgtaaagcatta
acacgtggtatgcgtaagtttggcgataagtttggacgtattagtttatgggtaatgaac
tcagatacttatttcgatattgtcgatgatgcaatcactaatcaaatttatggcgaatct
gaaatcgttatctatggtggtttaccgggtaccttaggtaagccggtattggttacagat
gccgtaggtgatgatgatgcatttggtttgcaaatgggtgcagttactgttacagaatca
caagtaccaggcttccgcgcgtatgacatcaatgatgaagaaaacttggcaatcggtatg
cgtgctgagggtacatttaacctagatattcttggttatagctgggatacatcaaaaggt
gaaaaccctgaccttactttacttggttcaagtgccaactggaaaaaacatgctactagc
aacaaaatgacagcaggcacattgcttgatctatctggcacaacaacaactggttaa

DBGET integrated database retrieval system