KEGG   Acinetobacter baumannii ACICU: ACICU_02742Help
Entry
ACICU_02742       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4055
Motif
Other DBs
NCBI-ProteinID: ACC58054
Position
complement(2913052..2914503)
Genome map
AA seq 483 aa AA seqDB search
MSDVTFKHPEYVKNLPYWQKLDDVCEGEDAVKAKGEKYLPKPNAHDQSPANKSAYEAYRT
RAVFYEVTGTTSNSLVGAAFATDPSFKFPPELAHLERNANGAGLSAYQLAQNGIRHLLKH
YRCALYVDYPAVTPARNLAEFKQQKAYPMIHLLNAIDVINWDSMMIDNQKKLCLVVIREF
TSERGADGFSKSEVEQYRVLRLEPDNEGNFIYTVQVYTKGDKGTWKGEDKKYPTDNNGDF
WSYIPFTFVGAIDNSEEIKKPPLLPLANLNLAHYRDSADFQESVFYMGQPQFYAKGVNWA
WYDEAKKRGIYIGAKVLLPLPENGDLGIVQADPNTLAREAMKDKWEQMKELGARLIEKGS
AAKKTATESNSDDAVQHSVLSLCVVNMNEALSMALRWAAKFVVPNVDVLTKDELMFEISQ
EFNKQGYLAELARQLFEAALQGRSSFKSWWEYNQTGMFPKQKYEEEILNVEAEQDGTLNQ
GVN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgtaacttttaaacatcctgaatatgttaaaaacttgccatattggcagaag
ctagatgatgtgtgtgaaggcgaggatgctgtaaaggctaaaggagaaaagtatcttccg
aaacccaatgctcatgatcaatcacctgcaaataaaagtgcttatgaggcttatcgtact
cgggcagtcttttatgaagtaacggggactacatctaatagtttagttggtgcagctttt
gcaaccgatccaagttttaaatttcctccagaactagctcacttagaacgcaatgctaac
ggcgcgggattaagtgcttatcaattggcacagaacgggatccgacatttattaaagcat
tatcgttgtgctttatatgttgactatcctgcagttacaccggctcgaaatcttgcggag
tttaaacagcaaaaagcctacccgatgattcacttattgaatgccattgatgtgatcaat
tgggattcaatgatgattgataaccagaaaaagctttgcttggtggtcatccgtgaattt
acttcagaacgaggcgctgatggctttagcaaatctgaggtagagcaatacagagtactt
cgtttagagcctgataatgaaggaaacttcatctatacagttcaagtttacacaaaaggc
gacaagggtacatggaagggcgaagataagaagtatcccactgataataacggggatttc
tggtcttatattccattcacttttgtgggggctattgataactctgaagagattaaaaag
cctccattgctcccattggctaatcttaatttagctcattatagagatagtgcggacttt
caagagtccgttttttatatgggccaaccacagttttatgctaagggagttaattgggct
tggtatgacgaggctaaaaagcgtggcatttatatcggtgcgaaagttctattaccttta
cctgaaaacggtgatttggggattgtacaagcagatccaaacacattagcacgggaagct
atgaaggataagtgggagcaaatgaaggagcttggtgctcgacttattgaaaaaggttcc
gcagctaaaaagactgctactgaatctaacagtgatgatgccgtgcagcattccgttctt
tcactttgtgttgtgaatatgaatgaagctttgtctatggctttacgttgggctgctaaa
tttgtagtacctaatgttgatgttctgactaaagatgaactgatgttcgaaattagtcag
gaatttaacaagcaaggttatttagctgagttggctcgtcaattgtttgaagcagcttta
caaggtagatcttcattcaaatcttggtgggaatacaaccaaacaggaatgtttcctaaa
caaaaatatgaagaagaaatcctaaatgttgaagctgaacaggatgggactttgaatcaa
ggagtgaattga

DBGET integrated database retrieval system