KEGG   Acinetobacter baumannii ACICU: ACICU_02752Help
Entry
ACICU_02752       CDS       T00710                                 

Definition
(GenBank) GP72
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1064
Motif
Other DBs
NCBI-ProteinID: ACC58064
Position
complement(2920247..2920654)
Genome map
AA seq 135 aa AA seqDB search
MTSMSLADYHSKFPNGHKAKKGRNKFNASKVTLDGMTFDSKKELKRYIELKAMQQRGEIF
GLEHHAKFELAPKTKIEGEKRTKPALRYFADFTYYLINGEYIVEDVKSIATRKLPSYRNK
KHLMKTVHGIDIREV
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgatgagtttagcggattatcactctaaatttccaaacggccataaagctaaa
aagggccgtaataaatttaatgcttcaaaagtcacattagatgggatgactttcgacagc
aaaaaagaactcaagcgatatatcgaacttaaagccatgcagcaacgcggtgaaatcttt
ggattagagcaccatgcaaaatttgaattggctcctaaaactaagatagagggggaaaag
agaacaaagccggcacttagatattttgctgattttacttactacctcatcaatggcgag
tacatcgttgaggacgttaagtctattgctactaggaaattacctagttatcgcaataag
aaacatttaatgaaaactgtacacggtattgatattagagaggtttga

DBGET integrated database retrieval system