KEGG   Acinetobacter baumannii ACICU: ACICU_02763Help
Entry
ACICU_02763       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 HTH_3
Motif
Other DBs
NCBI-ProteinID: ACC58075
Position
2926041..2926817
Genome map
AA seq 258 aa AA seqDB search
MDISAIRKANLIKLLEKYSTQKEFAELVDTPTSYITQITQGTLGKNGKPVSLGNTVARRI
EKMLNLEHGFMDVDHSTDHNNIVPFNPQVNPKSDDLRISPVEFKSSFENKNTIKIPVHKN
VRASCGDGVANFLEDVTDYLEVDPNFLRLMGINIKPERLRIIYSTEYSMWPTVVPDSPLF
VDTTPVDTSAMISGDVYVFMHNSLLRMKRVFISYGDEKTVRLQSDNPDKKKYPDEIITRE
QLNELVFLGRLELSLVKP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggatatttcagcaatacgcaaagccaaccttataaagttgcttgagaaatacagtact
caaaaagagtttgcggagttagtggatacaccgacctcctatatcactcaaattactcag
ggtactcttggtaaaaatggcaaaccggttagtctggggaatactgtcgccagaagaatt
gaaaagatgctaaatcttgaacatggctttatggatgttgaccactcaactgatcataat
aatattgttccttttaatcctcaggtaaacccaaagtctgatgacttgcgtatatctcca
gtcgaatttaaatcatcatttgaaaataaaaatacaattaagattcctgtgcataaaaat
gttagagcttcctgtggggatggtgtggctaatttcctagaagacgtaactgattacctt
gaagttgatccaaatttcttaagattaatgggtataaatattaagcctgaaaggcttagg
attatttactcaactgaatacagtatgtggcctactgtagtacctgatagtcctttattt
gttgatacaacaccagttgatacttctgcaatgattagcggtgatgtttatgtttttatg
cataacagcttattgcgaatgaaacgtgtgtttattagttatggtgacgagaagactgta
cgcctacaaagcgacaatccagataagaaaaagtatcccgatgaaatcatcaccagagaa
caattaaatgaactcgtttttttaggtagattggaactttcgctagttaagccttaa

DBGET integrated database retrieval system