KEGG   Acinetobacter baumannii ACICU: ACICU_02802Help
Entry
ACICU_02802       CDS       T00710                                 

Definition
(GenBank) Aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00250  Alanine, aspartate and glutamate metabolism
abc00760  Nicotinate and nicotinamide metabolism
abc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACICU_02802
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ACICU_02802
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     ACICU_02802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 Bundlin PaaX Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACC58114
Position
2960842..2962491
Genome map
AA seq 549 aa AA seqDB search
MRMDMPNQQTIHHFDVIIVGSGGAGLSLALSLPSHFNIAVLAKAALTEASTFYAQGGVAA
VLDETDSIQQHINDTMIAGAHLCEMDAVQHTVEGGRPSVDFLLKQGVQFTLDEDEQLHLT
REGGHSQRRIIHSADATGKAISTTLVERAKERKNITIFENYIAIDLITSHKLGHTEQANR
AIGLYALDESTEKVHTFLAPFTALACGGAMKAYLYTSNPDIATGDGIAMAYRAGCRVANM
EFNQFHPTCLYHPQARSFLITEAMRGEGAYLRLPDGERFMLRFDDRAELAPRDIVARTID
HEIKRLGIRHVWLDITHKSPEFIKEHFPTLYARLLELGIDITKDMIPVVPAAHYTCGGVV
VDSNSQTDIEGLYAIGETSYTGLHGANRMASNSLLECFVYGMSAAKDIESKFDINFKLPE
VPTWDDSQVTNPDEDVVILQNWDELRSTMWNYVGIVRTTKRLERALHRIEMLKREITEYY
QDYRVSKNLIELRNLVLVSEMIVRCAMHRKESRGLHYTLDYPETSSEIRKTVLTPPNFAV
EQPLVNTSV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatggacatgcctaatcaacagacaattcaccactttgatgtgattattgtgggc
agtggcggtgctggtttaagtctggctttatcgttaccaagtcattttaatattgcagtt
ttagctaaagctgctttaactgaagcaagtaccttctatgcacaaggtggtgttgctgca
gtacttgatgaaactgactctattcaacaacacattaatgacactatgattgcaggtgct
catttatgtgaaatggatgcagtccagcatactgtagaaggcggccgtccttctgttgat
ttccttttaaagcaaggtgtgcagtttaccttagatgaagatgaacagcttcatttgact
cgtgaaggtggccattcgcagcgccgtattattcattctgctgatgcaactggcaaagct
atttcaaccactttggttgaacgcgccaaagaacgtaaaaacatcactatttttgaaaac
tatattgcgattgatttaatcacgtcgcataagttaggtcatacagagcaggcaaatcgt
gctattggtttgtatgcactagatgaaagtactgaaaaagttcataccttccttgcccca
tttaccgcacttgcttgcggcggcgcaatgaaagcttacctttatacatctaatccggat
attgctactggtgacggtattgcgatggcataccgtgcaggttgccgtgttgccaatatg
gaatttaaccagttccatccaacctgcctttaccacccacaagcacgttctttcttaatt
actgaagccatgcgtggtgaaggtgcttacttacgtttaccagatggcgaacgttttatg
ctacgttttgacgatcgtgcagagttggctcctcgcgatatcgtggcacgtaccattgac
catgaaatcaagcgtctcggtattcgccatgtgtggttagacattacacacaaatcacct
gagtttattaaagagcacttccctacactttatgcacgattgcttgagttaggtatcgac
atcactaaagacatgattccggtggtgccagctgcacactatacttgtggtggtgttgtg
gttgactcaaatagccagactgatattgaaggtctatatgcaattggtgaaacctcttat
acgggtttgcatggtgcaaaccgtatggcgagcaactcattacttgaatgcttcgtttat
ggcatgagtgcagcaaaagatatcgaaagtaagtttgatataaacttcaaattaccggaa
gtacccacttgggacgattctcaagtaaccaatccagatgaagatgtcgtgattttacaa
aactgggatgagttacgttcgaccatgtggaactacgttggtattgtaagaaccacaaaa
cgtttagaacgtgcgttacaccgtattgaaatgctaaagcgcgaaattactgaatattat
caagattatcgtgtcagcaagaacctgattgaactgcgtaatcttgtacttgtttccgaa
atgattgttcgttgtgctatgcaccgtaaagaatcacgtggcttacattacacacttgat
tatccggaaacttcgagtgagattcgtaaaacggttctgacgcctccaaactttgcagta
gagcaacctttggtgaatacgagtgtataa

DBGET integrated database retrieval system