KEGG   Acinetobacter baumannii ACICU: ACICU_02807Help
Entry
ACICU_02807       CDS       T00710                                 

Definition
(GenBank) ABC-type sulfate transport system, periplasmic component
  KO
K02048  sulfate transport system substrate-binding protein
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00920  Sulfur metabolism
abc02010  ABC transporters
Module
abc_M00185  Sulfate transport system
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ACICU_02807
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    ACICU_02807
Transporters [BR:abc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    ACICU_02807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_6 PBP_like
Motif
Other DBs
NCBI-ProteinID: ACC58119
Position
2965857..2966864
Genome map
AA seq 335 aa AA seqDB search
MRFSQLKVGVIAALLSVSSFAAQEFLNVSYDPTRELYTDFNKQFGTYWKQRTGQDIEFKQ
SHGGSGKQARAVIDGLNADVVTLALAADIDEIAEKAKLLPTDWQKKLPQNSTPYTSTIVF
LVRKGNPKQIKDWGDLIKPGVEIITPNPKTSGGARWNYLAAWAWAKHQAGGNDAKAQEFV
RQIYKHTKVLDSGARGATTTFAERGIGDVLLAWENEAHLAIREQPGKFEIVTPSLSILAE
PPVAIVEKNAAKKGNLTIAKGYLNYLYSPAGQEIAARNFYRPRNAAVLKKYSNVFKPLKL
VTIDKEFGGWTKVQKQHFDNGGVFDQIVKINSAEK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttctcagttaaaagtcggggttattgctgcattactttctgtttcatcgttt
gcagctcaagaattcttaaacgtttcttacgatccaactcgcgagttatatacagatttc
aacaaacagttcggtacttactggaaacagcgtaccggtcaagatattgagtttaaacag
tcacacggtggttctggtaaacaggcccgcgctgtaatcgacggcttaaatgcagatgtt
gtgacattagcacttgctgctgatattgatgaaattgctgaaaaagcaaaattgcttcca
acagactggcagaaaaagttaccgcaaaactctactccgtacacatcaactatcgtgttt
ttagttcgtaagggtaaccctaaacaaattaaagattggggtgacttaatcaagccaggc
gtggaaattattacgccaaacccgaaaacttctggtggtgcacgttggaactatcttgca
gcttgggcttgggcaaaacatcaagcaggtggtaacgatgcaaaagcacaagaatttgtt
cgccaaatttataaacacaccaaagttttagattcaggcgcccgtggtgcaaccactaca
tttgctgaacgcggaattggtgacgtattactggcttgggaaaatgaagcacatttagct
atccgtgaacaaccaggcaagtttgagattgtgacgccatctttatctattttggctgag
ccgccagttgcaattgttgaaaaaaatgcagcgaaaaaaggcaacttaactattgcaaaa
ggttacctcaactatttgtactcacctgctggtcaagaaattgcagcacgtaatttctac
cgtcctcgtaatgcagctgtactcaaaaaatacagcaatgtatttaagccattgaaactt
gtcaccattgataaagaatttggcggttggacaaaagtacaaaaacaacactttgataat
ggtggtgttttcgatcaaatcgtgaaaatcaatagtgcagagaagtaa

DBGET integrated database retrieval system