KEGG   Acinetobacter baumannii ACICU: ACICU_02815Help
Entry
ACICU_02815       CDS       T00710                                 

Definition
(GenBank) Organic radical activating enzyme
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00790  Folate biosynthesis
abc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACICU_02815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abc03016]
    ACICU_02815
Enzymes [BR:abc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     ACICU_02815
Transfer RNA biogenesis [BR:abc03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    ACICU_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12 Glycos_transf_1 zf-CHCC
Motif
Other DBs
NCBI-ProteinID: ACC58127
Position
2973390..2974100
Genome map
AA seq 236 aa AA seqDB search
MASLRSSAIPVSDPASGLRITEIFYSLQGEANASGLPTVFIRLTGCPLRCSYCDTTYSFE
GGERLSLEHIIETAEKYQTPYICVTGGEPLAQPNCLILLQRLCDAGFDVSLETSGALDVS
RVDPRVSKVLDLKTPTSGEEHRNLISNLDHLTPRDQIKFVICNREDYEWSKQQVEQYQLQ
TKVSTVWFSPAFAVEKGAVGLPRLARDLAQWILDDKLPVRFQLQLHKLLWNDESGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttacgttcctctgcaattcctgtctctgaccctgcgtccggtctacgcatt
accgagattttttactccttgcagggtgaagcaaatgcctctggcctaccgactgtattt
attcgtctaacaggttgccctttacgttgtagttattgcgacaccacctattcttttgaa
ggtggcgaacgcttatcacttgagcacattattgaaacggctgaaaaatatcaaacgcct
tatatttgtgtaacaggcggtgaaccacttgcacaacccaattgcttaattttattacaa
cgtttgtgtgacgccggttttgacgtttccctagaaaccagtggcgctcttgatgtatca
agagtagatccgcgtgtttcaaaagtcctcgacttaaagaccccaacttctggtgaagaa
caccgtaatctcatcagtaatcttgaccatttaacaccgcgtgaccaaatcaaatttgtg
atttgtaatcgtgaagactatgaatggtcaaaacaacaagttgaacaatatcaactgcaa
accaaagtcagtactgtctggttctcccctgcttttgcagttgaaaaaggtgctgttggc
ctgccacgtttagcacgtgatctggcacagtggatactggacgacaaactgcctgtacgt
ttccagcttcagttacataaactgctctggaacgatgaatcaggtcgctaa

DBGET integrated database retrieval system