KEGG   Acinetobacter baumannii ACICU: ACICU_02833Help
Entry
ACICU_02833       CDS       T00710                                 

Definition
(GenBank) Biopolymer transport protein
  KO
K03562  biopolymer transport protein TolQ
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc01120  Microbial metabolism in diverse environments
Brite
Transporters [BR:abc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACICU_02833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB
Motif
Other DBs
NCBI-ProteinID: ACC58145
Position
2990126..2990824
Genome map
AA seq 232 aa AA seqDB search
MATNIESTLHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMSYKKARQDDEHFQKM
FWSGAEFNTLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRQAPTSQMIEGTERILRVGLS
RDQGSLEYGLGTLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIA
TAIGLFAAIPAVLAFNHFTAKSESVYSDRALFAEEMIALLQRQSVGSSQEDA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaacattgaatcaaccctgcatatttctgaccttattttacaagcaagtcca
gtcgtccagttggtcatgctgattttattgttagcatcaatttttagttggtacctgatt
gccaagttacatatgagttataaaaaagcacgccaagatgatgaacatttccaaaaaatg
ttctggtctggtgctgaattcaatacgctttacaacaacgcacaactcaattcaaaacgc
tcaggccttgaagatatcttttatcaaggattaagtgagttttttaaactcaaaaaacgc
caagctcctacctcacaaatgatcgaaggaacagaacgtattttacgtgtaggtttaagt
cgtgatcagggtagtctggaatatggtttaggtactttagcaagtatcggttcggttgcc
ccatatatcggtttattcggtactgtttggggaatcatgaatgcttttattggtttggct
gctgttgaccaagtgacgttagcgacagttgcgccaggtattgccgaggcccttattgca
actgcaattggtctatttgctgcaattcctgcggtattggcttttaaccactttacggct
aaaagcgaaagtgtctactctgatcgtgcattatttgccgaagagatgattgctttattg
caacgtcaatctgtgggttcgtcacaggaagatgcataa

DBGET integrated database retrieval system