KEGG   Acinetobacter baumannii ACICU: ACICU_02840Help
Entry
ACICU_02840       CDS       T00710                                 

Definition
(GenBank) rRNA methylase
  KO
K03437  RNA methyltransferase, TrmH family
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abc03016]
    ACICU_02840
Transfer RNA biogenesis [BR:abc03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    ACICU_02840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase SpoU_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACC58152
Position
2996047..2996823
Genome map
AA seq 258 aa AA seqDB search
MAVIFLESKDNAKIKHLRGLIELNSARKKHQQTVLEGTHLCLAWLQQQKKLFSLFTTEQA
LEHPDLKKIIELHQGHVFIISEVLYKDLSTLGNTLPCLAIIDLPKTASTIDYSVDTLILE
NVQDPGNVGTLLRSAAAANIKQIICTQGSASLWSPRVLRAGMGAHFSLSCFENFQLTDIL
PKFDIPVFVTSSHRSTSLYSKDLSKPCVWILGNEGQGASDYALEHAQSVTIPQPGGQESL
NVAIAGSICFFEMVRQRQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggttatttttttagaatcaaaagacaatgcaaaaattaaacatttgcgtggttta
attgaactcaatagcgcccgaaaaaagcatcaacaaacagttcttgaaggtacccacctt
tgtctagcttggttacaacaacagaaaaaactcttttcattgtttacgactgaacaagcc
ttagaacatcccgatttaaagaaaatcattgaacttcaccaaggtcatgtctttattatt
agcgaagttttatataaagacttaagtactttaggtaatactcttccttgcttggctatt
atcgatttaccgaaaactgcatcaaccattgactatagcgtagatacgttaattctagaa
aatgtacaagatccgggtaacgtaggtacattgttacgttcagcggcagcagcaaatata
aaacagattatttgcacacaaggctctgcctcactttggtctccacgagttttaagagca
ggtatgggggcacattttagcctgtcttgttttgaaaactttcaattaaccgatattctt
cctaaattcgatattcctgttttcgttacaagctctcatcgctcgactagtctttattca
aaagacctttcaaaaccatgtgtttggattttaggcaatgaaggacaaggtgcaagtgat
tatgctttagaacatgcacaatcagtgactataccgcagccaggtggtcaagagtcatta
aatgtagccattgcaggatcaatttgtttttttgaaatggttcgccaacgccaataa

DBGET integrated database retrieval system