KEGG   Acinetobacter baumannii ACICU: ACICU_02845Help
Entry
ACICU_02845       CDS       T00710                                 

Definition
(GenBank) putative outer membrane protein A
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACC58157
Position
complement(2999141..3000811)
Genome map
AA seq 556 aa AA seqDB search
MKNYQKVLGVLTVIAAMPLMAQTTIKVTTFNDEDNENMNTCSLREAITAAEMRKSYGGCE
VPAIDQNYTIQLDAGTYTLNKELTPKIALNIIGKEATDWERKGVLTNDYPAQKPLQTRIN
AGGKSRIFNTAVYQQSLTLTNIILENGKSAEQGGAIYAGADVTLKNSQILNSQASKGGAI
YLGGSTASLTMNHSLVQGNGKASTEGSILAMSCMFNNSYSGRIFSFDSNSFIDNGGINSI
SIFDFCGSPTAKFTNNTIAKNLASLTNGNIIKFTGDADPLKNQTSKLSSSSSLTLQNNTI
VENSAYTTFLYDKLGTKELNFNILAFNTGSYACKYLLGAAAAEKDTGLNLKFNALNLNGN
TPKCDIPTEVISTGNTNIDIKNEVFSNLLEPLKEANENNGFLPIYYPKNNFSATDLIDVD
LENKGTCQTQDQRGLSRLVSNTYYYQTLEKSKNSCDIGSVELMKLTAGDLEGLSNISFTT
LLETYQKSYDLYDSLLKDPTTPSNFIVYYKVRLAEFKDLLDKFKNDSAHINTKYRAIYID
LKTMVFHYQLKIQIMY
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactatcaaaaagtactaggagtacttactgttatcgcagcaatgcctttaatg
gctcaaactactataaaagttacaacatttaatgatgaagataatgagaacatgaataca
tgttctttacgtgaagctattacagctgcagaaatgagaaaatcttatggagggtgtgag
gttccagcaattgatcaaaattatacaattcaacttgatgctggtacctataccttaaat
aaagagttaacacctaaaattgctttaaatattattggaaaagaggcgacagattgggag
cgtaaaggagttttaactaatgactatcctgctcaaaaacctcttcaaactcgtataaat
gctggtggaaaatcacgaatttttaatacagctgtttaccaacaatcgttaactttaacc
aatatcattttggaaaatggtaaaagtgctgagcaaggtggagcaatttacgctggtgct
gatgtaactttaaaaaatagccagatcttaaactctcaagcctctaaaggcggggcaatt
tatcttggcggaagtactgctagtttaacaatgaatcattcattagttcaaggtaatggt
aaggcttcgactgaaggtagtattttggcaatgagttgcatgtttaataattcatacagt
ggacgtatcttttcatttgattcaaatagttttattgataatggtggaataaactctata
agtatttttgatttttgcggtagtcctacggcgaaatttactaataatacaattgctaaa
aatttagcgagtcttactaatggtaatattattaaatttactggagatgctgatccatta
aaaaatcaaactagtaagttaagctcatctagtagtttaacattgcaaaataatacaatc
gttgagaactctgcatacaccacatttttatacgataaattaggtacaaaagaattaaat
tttaatatattagcgtttaatacaggttcttatgcatgtaaatatttattaggagcagcg
gcggctgaaaaagatactggactaaatttgaaatttaatgcattaaacttaaatggtaat
actcctaaatgtgatataccgacagaagtaatttctacaggcaatacgaatattgatata
aaaaatgaagtttttagtaatttattagaacctttaaaagaagctaatgaaaataatggt
tttttaccaatttactatcctaaaaataatttttcagcgacagatttaattgatgttgat
ttggaaaataagggtacatgccaaactcaggaccaacgtggattatcgagattagtaagt
aatacgtactattatcaaactctagaaaagagtaaaaatagttgtgatattggttcagtt
gaattaatgaagcttacagcaggtgacctagaaggtttaagtaatatttcatttacaaca
ttattagaaacctatcaaaaaagttacgacttatatgatagtttgctcaaagatccaaca
actccatcaaattttattgtttattataaagtccgtttagctgaatttaaggatttactt
gataaatttaagaatgacagcgcgcatataaatacaaaatatcgagctatttatattgat
ttaaaaactatggttttccactaccaactgaagattcaaatcatgtattaa

DBGET integrated database retrieval system