KEGG   Acinetobacter baumannii ACICU: ACICU_02881Help
Entry
ACICU_02881       CDS       T00710                                 

Definition
(GenBank) Phosphoglycerate dehydrogenase
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00750  Vitamin B6 metabolism
abc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACICU_02881
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     ACICU_02881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DUF3410 XdhC_C NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACC58193
UniProt: B2HX89
Position
complement(3042505..3043572)
Genome map
AA seq 355 aa AA seqDB search
MKIVADENLAFTDYFFSEFGDIQYKAGRTLTHTDVQDAEALLVRSVTAVNESLIQNTALK
YVGSATIGTDHLDIQALEKQGITWANAAGCNAQAVAEYVITALLHLDASLLEQQEKFTLG
IVGLGNVGKRLAYMAQLLGWKVIGFDPYVQLDSIENVSFQTLLQQANAVSIHVPLTKKGE
HATYHLFDEKAFAALQPNTILINSARGPVVKEAALIEDIQRTQRKVVLDVFEHEPVISEE
LLNMLALATPHIAGYSLEGKARGTQMIYEAFCQKFGYDINKRFETQLPACEDYFSGHDLK
AVLKQKLSQIYDIAQDDANIRACVKEGKVEQKAFDLLRKNYPLRREWAAHGGPQA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtcgcagatgaaaatttggcgtttaccgattactttttttcagagtttggc
gatattcaatataaagcagggcgcaccttaacgcatacagacgtacaagatgctgaagct
ttattggttcgttcagtcaccgcagtaaatgaaagtttaattcaaaataccgccctaaaa
tatgtgggcagtgccacaatcgggaccgatcatttagatattcaagctttagaaaagcag
ggcattacatgggccaatgcagcaggttgtaatgcacaggcggttgctgaatatgtcatt
acagctttactgcatttagatgctagccttttagaacaacaagaaaaatttacgctaggc
attgtggggcttggcaatgtcggtaagcgcttggcctatatggctcagttgcttggttgg
aaagtgattggcttcgacccctatgtacagttagattcaattgaaaatgtaagctttcaa
accttgttgcaacaagctaatgcagtttcaattcatgtgccgctgaccaaaaaaggcgaa
catgcgacatatcatctgtttgacgaaaaagcttttgcagcgcttcaaccgaacacgatt
ttaattaatagtgcacgtggtccggtcgtaaaagaagccgctttaatcgaagacattcaa
cgtacccagcgtaaagtggtactcgatgtatttgagcatgagccagtgatatctgaagag
cttttaaatatgttggcgttggcgacaccgcatattgcaggttatagcttggaaggaaaa
gctcgtggtacgcaaatgatttatgaagcgttttgtcaaaaatttggatatgacattaat
aagcgtttcgaaacccagttgcctgcatgtgaagactatttttcaggacatgatttaaaa
gcagtgttaaagcaaaaactatctcaaatttatgatattgctcaagatgatgccaacatc
cgtgcctgtgttaaagagggcaaggtagagcaaaaagcatttgatttattacgtaagaat
tatccgctgcgccgtgaatgggcagctcacgggggaccacaggcatga

DBGET integrated database retrieval system