KEGG   Acinetobacter baumannii ACICU: ACICU_02913Help
Entry
ACICU_02913       CDS       T00710                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (GTP)
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00010  Glycolysis / Gluconeogenesis
abc00020  Citrate cycle (TCA cycle)
abc00620  Pyruvate metabolism
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
Module
abc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACICU_02913
   00020 Citrate cycle (TCA cycle)
    ACICU_02913
   00620 Pyruvate metabolism
    ACICU_02913
Enzymes [BR:abc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     ACICU_02913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_C PEPCK_N
Motif
Other DBs
NCBI-ProteinID: ACC58225
UniProt: B2HXC1
Position
3088189..3090021
Genome map
AA seq 610 aa AA seqDB search
MTTVNAPEFVRHPKLIAWVEEIANLTKPAKIEWCDGSEEEYQRLIDLMIANGTMQKLNQE
KHPGSYLANSDPSDVARVEDRTYICSQNKEDAGATNNWEDPAVMREKLNGLFEGSMKGRT
MYVVPFSMGPLGSHIAHIGIELTDSPYVAVSMRKMARMGKAVYDVLGTDGEFVPCVHTVG
APLAEGQKDVAWPCNPEKYIVHYPETREIWSFGSGYGGNALLGKKCLALRIASVMGREQG
WLAEHMLILGVTNPQGEKHYIAAAFPSACGKTNFAMLIPPAGYEGWKIETVGDDIAWIKP
GEDGRLYAINPEAGFFGVAPGTNTKTNPNCMATLHKDVIYTNVAVTDDGQVWWEGLSKEV
PANLTNWKGQPHVNGEKAAHPNARFTVAAGQCPSIDADWENPAGVPISAFIFGGRRADTV
PLVSEAFDWVDGVYKAATMGSETTAAAVGQQGIVRRDPFAMLPFAGYNMADYFDHWLNLG
AKVSEKAEASGNKLPKIFNVNWFRRDAEGNFVWPGFGQNMRVLEWIIDRCEGRANAVETP
IGFVPTYEDLNWEGTEFTKEQFDLITNQDKDQWVTEIESHTELFNKLGERLPKALKERQA
ALLEAVKTGF
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagtgaacgcaccagaattcgttcgtcatcctaagcttatagcatgggttgaa
gaaattgcaaacttaaccaaaccagcaaaaatcgaatggtgtgacggaagcgaagaagag
tatcaacgtctaatcgacttgatgatcgctaacggcaccatgcagaaattaaaccaagaa
aaacatcctggttcttatcttgcaaattctgacccatctgacgttgcgcgtgttgaagat
cgtacttacatctgctctcaaaataaagaagatgctggtgcgacaaacaactgggaagat
ccagctgttatgcgtgaaaaattaaatggtttatttgaaggttcaatgaaaggccgtacc
atgtacgttgttcctttctctatgggtcctttaggtagccatattgctcacattggtatc
gagttaactgactctccttatgtagctgttagcatgcgcaaaatggcacgtatgggtaaa
gcagtttatgacgtattaggtacggatggcgagtttgttccttgcgtacatacagtaggt
gctccacttgctgaaggtcaaaaagatgttgcttggccttgtaacccagagaaatatatc
gttcattacccagaaactcgcgaaatctggtctttcggttctggttacggcggtaacgcg
ttacttggtaaaaaatgtttagctcttcgtatcgcttctgtcatgggacgcgaacaaggt
tggttagctgaacacatgcttattcttggtgtaactaaccctcaaggtgaaaaacactac
atcgctgctgcattcccgtctgcttgtggtaaaacaaactttgcaatgttaattccacca
gcaggttatgaaggttggaaaatcgaaactgtaggtgacgatattgcttggattaaacca
ggtgaagatggtcgcttatatgcgattaaccctgaagctggtttcttcggtgtagcacct
ggtacaaataccaaaactaacccgaactgtatggcaactcttcacaaagacgttatctat
acaaacgtagcagtaactgacgatggtcaagtatggtgggaaggtctttctaaagaagtt
ccagcaaacttaactaactggaaaggtcaacctcacgtaaacggcgaaaaagcagcacat
ccaaatgctcgtttcactgttgcagcaggtcaatgtccatctatcgatgctgattgggaa
aacccagcaggtgttccaatttctgcattcatcttcggtggtcgtcgtgcagatacagta
cctttagtttctgaagctttcgactgggttgacggtgtatataaagcggcaactatgggt
tctgaaactactgctgctgctgttggtcaacaaggtattgttcgccgtgacccattcgcg
atgcttccatttgctggctataatatggctgattactttgaccactggttaaaccttggt
gcgaaagtaagtgaaaaagctgaagcttctggcaacaaattaccaaaaatcttcaatgta
aactggttccgtcgtgatgctgaaggcaacttcgtatggcctggtttcggtcaaaacatg
cgtgttcttgagtggatcattgatcgttgtgaaggtcgtgcgaacgctgttgaaacacct
atcggttttgttccaacatatgaagacttgaattgggaaggtactgagttcactaaagaa
caatttgacctcatcacaaatcaagataaagaccagtgggttactgaaattgaaagccac
actgagttattcaataaacttggcgaacgcttacctaaagcattaaaagaacgtcaagca
gctttacttgaagctgtaaaaactggcttctaa

DBGET integrated database retrieval system