KEGG   Acinetobacter baumannii ACICU: ACICU_02925Help
Entry
ACICU_02925       CDS       T00710                                 

Definition
(GenBank) 23S rRNA methylase
  KO
K02427  23S rRNA (uridine2552-2'-O)-methyltransferase [EC:2.1.1.166]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.166  23S rRNA (uridine2552-2'-O)-methyltransferase
     ACICU_02925
Ribosome biogenesis [BR:abc03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    ACICU_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_31 DUF4800 TPR_20
Motif
Other DBs
NCBI-ProteinID: ACC58237
UniProt: B2HXD3
Position
complement(3103622..3104272)
Genome map
AA seq 216 aa AA seqDB search
MATRITNQKLSKSSRAWMREHLDDPFVKKAQKEGYRARAAYKLLEIQEKYKLIKPGMTVV
DLGAAPGSWSQIAGKLVGSKGLVIASDILPMDALPDVTFLQGDFREEAVFEKLLNILNGR
QVDIVISDMAPNTSGNRAVDQPRQIYLCELALDFAQKVLGPNGQFVVKVFQGAGFDEFRK
QVVDSFDVLKTAKPAASRARSKEVFLVGQGRKKALQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacgcatcaccaaccaaaaattgtctaaaagtagtcgtgcgtggatgagggaa
catctagacgatccttttgtaaaaaaagcacaaaaggaaggatatcgtgcacgagcagcg
tataaacttcttgaaattcaagaaaaatataagttgatcaagccaggcatgacagtggtg
gacttgggagcagctcctgggagttggtcacaaatcgctgggaaactcgttggtagtaaa
ggattggttattgcttccgatattttacctatggatgctttgccagatgtcactttctta
caaggcgacttcagagaagaagctgtatttgaaaaattgttaaatattttaaacggaaga
caagtagacattgtaatttctgatatggcccccaatacatcaggtaatagggctgttgat
caacctcgacagatttacttgtgtgaacttgctttagactttgctcagaaagtcttgggt
ccaaatggacagtttgttgttaaagtgttccaaggcgcaggatttgatgagtttcgtaaa
caagtcgttgatagttttgatgtgttaaaaacagcaaaaccagcagcttctcgggcacga
tctaaagaagtttttttggttggacaagggcgtaagaaagcattgcaataa

DBGET integrated database retrieval system