KEGG   Acinetobacter baumannii ACICU: ACICU_02927Help
Entry
ACICU_02927       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACC58239
Position
3104810..3105346
Genome map
AA seq 178 aa AA seqDB search
MASYELSAFDRFHAVSVVGAIEQQAPYTLNVGFWIRDPNQLIIWPQEVAAHPRQDFLWEE
TCFEIFIGVHDEDFYREINLSPSQAWQTYQFEEYRYPESMPPLVAYDIELNHLKRTHYGL
NVSLDLSQFMQQHRLKWANLYLGLTAVLKTKDGMQYYAMQHSGKHADFHNKRDWLHEF
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttacgaactttcagcttttgatcgttttcatgctgtttctgttgttggcgca
attgaacagcaagccccatatacattaaatgtgggtttttggattcgtgatccaaaccaa
ctaattatctggccccaagaagtcgcagctcatcctcgccaggactttttgtgggaagag
acttgttttgaaattttcattggcgtgcatgatgaagatttctaccgggaaattaatctt
tccccttctcaagcatggcagacttaccagtttgaagaatatcgctatccggaaagcatg
cctcccctcgttgcttacgatatcgaattgaatcatctcaaacgtacccactatgggtta
aatgtaagtcttgacttaagccagtttatgcaacagcaccgcttaaaatgggcaaacctt
tatctaggtttgactgctgttttaaaaacaaaagatggtatgcagtactatgcaatgcag
catagtggaaaacatgctgattttcacaataaacgtgattggctgcatgagttttaa

DBGET integrated database retrieval system