KEGG   Acinetobacter baumannii ACICU: ACICU_02934Help
Entry
ACICU_02934       CDS       T00710                                 

Definition
(GenBank) predicted methylated DNA-protein cysteine methyltransferase
  KO
K07443  methylated-DNA-protein-cysteine methyltransferase related protein
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    ACICU_02934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_binding_1
Motif
Other DBs
NCBI-ProteinID: ACC58246
Position
complement(3112582..3112923)
Genome map
AA seq 113 aa AA seqDB search
MSTFMDSILTTQYELHRQILEVIALIPYGKVATYGQVARMAGLPKHARLVGYVLKHLEAD
HQVPWHRVINSQGKISLSKFNEKGENIQQLKLETEGIYLLNGKVNLKQFAWQP
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtttatggattccattttgacaactcagtatgaactacatcgacaaatttta
gaagtcatcgctttgattccatatggaaaagttgcaacttatggccaagttgctcgtatg
gcaggtttacctaaacatgccagattagttgggtatgtgcttaaacatcttgaggcagat
catcaggtcccttggcaccgtgttattaattcgcaaggtaaaattagcctaagtaagttt
aatgaaaagggcgaaaatattcagcagttaaagcttgaaacagagggaatctatttatta
aatggcaaagtaaacttaaagcaatttgcttggcagccttaa

DBGET integrated database retrieval system