KEGG   Acinetobacter baumannii ACICU: ACICU_02936Help
Entry
ACICU_02936       CDS       T00710                                 

Definition
(GenBank) putative enzyme of poly-gamma-glutamate biosynthesis (capsule formation)
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGA_cap Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ACC58248
Position
complement(3113706..3115430)
Genome map
AA seq 574 aa AA seqDB search
MTYPLFEIKLLTALDHAQFEEAIWAFEIDGDISTLLLIDYALEQFHQKKVQADEVYRVPE
QKIKKIGEQNLGLEKNESYTFAELLQFLIFTQANDVKDALSNMLFGSIEQTQLILFKRAE
DYQLALRAPNQLKNLFLLVKHIYSYPAELKKLFFIRTLSFKNKVYQPITPLLAHPVLTSV
LYISHTFRQIYITYSEHNRSIGFFSFLDDIHRLEHMVPYYHYFQEGHVEAKKYSSQTGII
NILGDTYFGEMYTEKRKSRGQTDALQQYGYHYSFEKIQPFLGKNDINIANFEAVFSLENQ
SPLKDKKPFVLKADAKKTLEEFKSIHLNYLVLANNHLKDYGEQGLAYTLHQLDQASISYI
GAGLNQKDAHNYFEITFETKHYAIFNGYWHRDTAYLDYDFYALGSRSGVACLNGVLLEQI
MRYKQAHPERKIIVICHWGVDFKPITKDQTKLATILTQAGADLIVGHGAHTIQPIQIINQ
KPVVFNIGNAVFNSDGEYEQQNALPFGCIARLDLAKDIIRLYPIYTNNLQTFWQPYPVDA
EDFSKASIYMTSLLTPENYMASQDKLGRYLEVKF
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgacttaccctctatttgaaattaagctgctaaccgctcttgatcatgctcaatttgaa
gaggcaatttgggcatttgaaattgatggagacatttctacattattactgattgattat
gcattagaacaattccatcaaaaaaaagttcaagctgatgaagtctatcgggttcctgaa
caaaaaattaagaaaattggtgaacaaaatttaggtctagaaaaaaatgaatcatataca
tttgctgagctcttacaattcttaatttttactcaggcaaatgatgttaaagatgcctta
agcaatatgctgtttggctctattgagcaaacacaattaatcttgtttaaaagagcagaa
gattaccagttagctttaagagcacctaatcaattaaaaaatctatttttgttggtaaaa
cacatttatagctatccagccgagctgaaaaaacttttctttattagaacactttctttt
aaaaataaagtatatcaaccgattacgcctttgcttgctcatccggtactcacttcggtt
ttatatatctcacatacctttagacagatttatatcacttattccgaacataaccggagc
attggttttttctcttttctggatgatattcaccgtctggagcatatggttccttactac
cattattttcaagaagggcatgtcgaggccaaaaaatattcttctcaaacaggcattatc
aatattcttggagatacctattttggtgaaatgtataccgaaaagcgtaagtctagaggg
caaacagatgccttacagcaatatgggtatcattattcatttgaaaaaatacagcccttt
ttaggtaaaaatgacatcaacatcgctaactttgaagcagtattttctttagaaaatcaa
tcgccgttaaaagataaaaagccatttgttctaaaagcagatgctaaaaaaacattagaa
gaatttaagagtattcatctaaattatttggttttagcaaataaccatttgaaagattac
ggtgagcaaggattagcctatacattacatcagttggatcaggcgagtatttcttatatt
ggcgctggactgaaccaaaaagatgctcacaattactttgaaatcacttttgagactaag
cactatgcgatttttaatggttattggcatagagacacggcttatctggattatgacttt
tatgcgttaggatcaagaagtggagtagcttgcttaaatggcgttttacttgaacaaata
atgcgttataagcaggctcatccagaacgcaaaattattgttatttgtcattggggtgtc
gactttaagcctattacaaaagaccaaactaaactcgcgactattcttactcaagcagga
gcggatctgatcgttggtcatggtgctcatactattcaaccaatccagatcatcaatcaa
aagcctgttgtttttaatataggcaatgcagtctttaatagtgacggtgaatatgaacag
caaaatgctttgccatttggctgtatagctagacttgatttagcaaaagatatcattcgc
ctttaccccatttacaccaataatttacaaacattttggcagccttatcctgtagatgct
gaagacttctcaaaggccagtatttatatgacatctttactgacccctgagaattacatg
gcatcccaagataaattagggagatatcttgaagttaaattttaa

DBGET integrated database retrieval system