KEGG   Acinetobacter baumannii ACICU: ACICU_02938Help
Entry
ACICU_02938       CDS       T00710                                 

Definition
(GenBank) hemolysin-type calcium-binding region:RTX N-terminal domain
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACC58250
Position
complement(3117231..3123650)
Genome map
AA seq 2139 aa AA seqDB search
MLNGTNYTVTAADLANGYITATLDATAADPVTGQIVIHAEAVDAQGNVDVADADVTVTID
TTPQDLITAITVPEDLNGDGILNAAELGTDGSFNAQVALGPDAVDGTVVNVNGTNYTVTA
ADLANGYITAILDATAADPVTGQIVIHAEAVDAQGNVDVADADVTLTIDTTPQDLITAIT
VPEDLNGDGILNAAELGTDGTFNAQVALGPDAIDGTVVNVNGTNYTVTAADITNGYITAI
LAATAADPVTGQIVIHAEAVDAQGNVDVADADVTVTLDVTPPDITTTVLAIDPVTADNIL
DATEAGGTVTLTGTLTNVPADATTTGVVVTINGNDYTATVDAIAGTWTVNVAGNDLALDP
DLTVDAKATFTDLAGNSSTLQDTQTYTLAGSITAFDNTDHAVLSPKPALVGDDVSLGSTS
YLVLTSVAGLDLQLGGNSLGFTVAAGHEGDVTFQYSGLIDAAVLSDYKLVVQKFNTTTNQ
WESIHGDANSSLISLHLLGIGTGNVPGAVLDGLDAGQYRAFLAYDGLLGLGVLGTLSATM
DDYDLSVAGGYEIGNAEGNVITDPDPTTGQVDQVTANTYVSSVNGHPIDADGETFAGTYG
TITFYQDGSYVYVPNADGSGVGQTDVFTYTLTDSVTGATGQANLNIVFDSIRAADNLVEV
ELNPQYQLVGTETDSAFYGVLLNVGNIVDLQLLTVDTVDFTIGAGQEGVATFNFNSLIGA
SALGDYNVVLQKYNDVTGQWEAVNGTGDRSLLNLTLLGNTPTAQIGGLTEGEYRAFLSFN
GLVGGAVAVTLNGSVDVYNPAVITGYDVVAAHGNLISDPNTNGDVDIATPNSIISEVNGV
AVSASPTEIIGTHGTLLIYANGDYTYTPNADSAGLGQVDQFTYTLLDPASNITSQATFYV
HLDSKVVDMNWDAADPSQPATVTITAVDDAVNAAIAAEPHLIEDDRALGSATYLALLSLA
GINLQAPLPFVNSTVEFNVGAGETGTATFKYSSLINEGALGDYQLVVQKFNTATNRWESI
TGSSEASLLNLSVLGIGVNATPGVVVEGLDEGQYRAFMTYNGLYGKSILGTLSGTMDVYD
PNQIDFTGLASEGNVITGLGVGTNADAVTGYTIVDSVTVNGVTTNVDPNTGTIIQGQYGT
LQIFANGDYIYTPNNTNANLGLVDHFTYTLADPLGGNISASLDFTIGNSTPVIAVDDLAV
AVVNPEYLQIGNDVAVDSYLYVALLSLTDNFDFQLGGQGVDFTLTDSTLNDVTFNYSALI
DASLLADYVLVVQKFDTATNQWVAVNGTGEADLLSLAAFGGNSVTLEGLAAGQYRAYMTY
AGSGVGVSLLGTLSVQKDVFDATNITGYSTQVAEGNVIHDVGLNGHADTASGFSTVTSVE
FNGTAFAVNATGVTTIVGDHGTLSIYANGNYSYQPNGEAASLGQVDQFTYTLSDGLNTSQ
ATLYLHIDSDAVDMTWNTSDPSQPAVITVTPVDAIDNVVSAGVDIVPQGELGVAVGSATY
LALVGITEDLNVSLLGTPSVAFTIDAGHEADVTFAYAPVLSLSLFNDYKVVLQQKGADGA
WHNIDGGSSTGLLNIGLLGNGGIGVTVPDLGQGEYRAFMVYTGLGVGILGTMSVVKDDFD
YTVAPTNTAVVADGNVLTDDVTTLTTQVTTVTSEVVGALPQTVGTDTVINGAYGTLVIST
NGHYTYTPNTTDLSAIGKVDSFTYTIRDVLTGATDTATLHVQVGSPDVTIAWDAANPAND
GVVQLTANPDHVVTTTDFSNAADLPVDVASPVVSVNLIGSNSVVSDQFVVGAGTVANIDL
SAVYTAQPLASVLPTVSYVIQSWNGTAWVNTIYSGSQTALGSVATIQAGSVAFQDTVEHL
AAGTYRVQYTLTGVSLGATSLDTNVSTTTVHLDTYRSDWISGNVLAGDNIGGVADTGILS
HEGAKLQVWDNAQNAYVDAVGQTINTGNGVLIMQSNGEYEYRPNDVTTTTQLASTDSINY
KIVSVTGGVESQSTLTIDLTHTDYNLLYTSTSANDTFTTGTGSDTVIYQLLNGTAATANN
GANTGGNGVDTWTDFHVGNVATDKQADLIDIRALLDGDQTDANIGQYLNVTTSGGNTTIQ
IDRDGLSGLIPGNNFTTLLVLQGVTTTETELLNNGQILY
NT seq 6420 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacggtactaactacaccgtgacagcagctgaccttgcaaacggctatatcaca
gcaactctggatgcaacagcagccgatcctgtgactggtcagattgtgattcatgctgag
gctgtagatgcgcaaggtaacgtagatgttgctgacgcagatgtaacggtaaccattgat
acaactccacaagacctgattacagcaattacggtccctgaagacctaaatggcgacggt
atcttgaatgctgcagaacttggtacagatggcagcttcaatgcacaagtggcattagga
ccggatgcagttgatggcacagtggtgaatgttaacggtactaactacaccgtgacagcg
gctgaccttgccaacggctacatcacagcaattcttgatgcaacagcagccgatcctgtg
actggtcagattgtgattcatgcagaagcagtggatgcacaaggtaacgtagatgttgct
gatgcagatgtaaccttaaccattgatacaactccacaagacctgattacagcaattacg
gttcctgaagacttaaatggcgacggtatcctgaatgctgcagaacttggtacagacggt
acattcaatgcacaagtggcattaggaccggatgcaatcgatggcacagtggtgaatgtt
aacggtactaactacaccgtgacagcagctgatattaccaacggctacatcaccgcaatt
cttgctgcaacagcagccgatcctgtgactggtcagattgtgatccatgctgaggctgta
gatgcgcaaggtaacgtagatgttgctgatgcagatgtaacagtaacactcgatgtcact
ccacctgatatcactacaacagtattagcaattgaccctgttaccgcagacaatattctt
gatgcgacagaagctggtggaacagtaactttaactggtacattgaccaacgttcctgca
gatgcaacaaccactggtgtagtggtgactataaatggtaatgactacacagcaacagta
gatgctatagcgggtacttggacagttaatgttgcgggcaatgaccttgctctagatcca
gacttaactgttgatgctaaagcgactttcacagatctcgctggaaacagtagtactcta
caagatacacaaacttatactcttgcaggttctatcactgcctttgacaacactgatcat
gcagttcttagtccgaaaccagcgcttgttggtgatgatgtaagtctaggtagtacttct
tatttagtacttacatctgtagcaggcttagaccttcaacttggtggtaattctctagga
tttactgtcgctgctggccatgaaggtgatgttactttccaatatagtggcttaatcgac
gcagctgtactttctgattacaagttagtagttcagaagttcaatacaacaactaaccaa
tgggaatctatacatggtgatgctaattcatcattaattagcttgcacttgttaggtatt
ggtacaggaaatgttcctggtgcagtccttgatggtttagatgcgggtcaataccgtgcc
ttcttagcctacgacggactgttaggattgggcgtgttaggcactctttctgccactatg
gatgattatgatttgtctgtagcaggtggatatgaaattggtaatgctgaaggtaacgtg
attactgatccagatccaacaacaggtcaagtcgatcaggtaactgcaaatacttatgtt
tcatcagtgaatggtcatccgattgatgctgatggagagacatttgcaggtacttacgga
acaattactttctatcaagatggtagttatgtgtatgtaccaaatgcagatggttctggt
gtaggtcaaactgatgtattcacatatacgttaactgactcagtaactggagcaacaggt
caagctaatcttaatatcgtgtttgattcgattcgtgcagcggataaccttgttgaggtt
gaactcaatccacaatatcaattggtgggtacagagactgattcagcattctatggcgtt
ctattgaatgttggaaatattgttgacctacaactcctcacagtagatacggttgacttt
actatcggtgctggtcaggaaggggttgcaacatttaacttcaatagcttgattggtgca
tctgctttaggtgactacaatgttgtgttgcaaaaatacaatgatgtgacaggacaatgg
gaagcagtgaatggtacaggtgatcgttcattactgaacttgaccttgcttggtaatacg
ccaactgcgcaaataggcgggcttacagagggtgaatatagagcattcttatcattcaat
ggcttggtaggcggagcagtagctgtaacattaaacggcagtgtagatgtctataaccca
gcggttattactggttacgatgtcgtagcagctcatggcaacctaatctctgatccaaat
acgaatggtgatgttgatatcgctacacctaacagtattatcagtgaagtcaatggtgtt
gcagtaagtgcatctccaactgagattattggtactcacggtactttactcatctatgca
aatggtgattatacctatacgccaaatgctgatagtgctggattaggtcaggttgatcaa
tttacttataccttgttagacccagcttctaatataacttcacaagctacgttctatgta
catctagatagtaaagttgtggatatgaattgggatgcagctgatccatcacaacctgct
actgtaacgattacagcagtggatgacgctgtaaatgctgcaattgctgctgagcctcat
ctcatcgaagatgacagagcattgggtagtgcaacttatcttgcattgttatcgttggct
ggcatcaacctacaagctcctttaccattcgtgaatagtactgtggagttcaatgtaggt
gctggtgaaactggaaccgcaacctttaaatacagcagtttaattaatgaaggagcactc
ggtgattaccaacttgtagtacagaaattcaatactgctacaaatcgttgggaatcaatt
accggtagcagtgaagcttctttactgaacttaagtgtattgggtataggtgtgaatgcg
acaccgggagtggttgttgaagggcttgacgaaggtcaataccgtgcctttatgacatac
aacggcctctatggtaagagtatcctaggtacattgtcaggtacgatggatgtttacgat
ccaaaccaaattgactttactggtttggcatctgaaggcaatgtcattactggtcttggc
gtaggtacaaatgctgatgctgtaactggatacacaattgttgattcagttactgtaaac
ggtgtgactacgaatgttgatccaaatactggaacaattattcagggtcaatacggtacg
cttcaaatattcgcgaatggtgattacatctatacgccgaataatacgaatgccaacctc
ggtctagtcgatcacttcacttatacgttggctgatcctttgggcggcaatataagtgca
agtctagacttcactattggcaacagtacgccagtgattgccgtagacgaccttgctgta
gctgttgttaatccagaatatctgcaaattggtaacgatgttgcggtagatagctaccta
tatgtggcgttattaagcttaactgacaattttgacttccagttgggtggacaaggtgtt
gactttactttgaccgatagcaccttaaatgatgtgaccttcaattacagtgcattaata
gatgcaagtctgcttgctgattatgtactcgtggttcagaaatttgatactgcaaccaat
caatgggtagctgtaaatggcactggagaagcggacttactcagtctggcagcctttggt
ggaaattcagtgacattggaaggtctagctgctggtcaatatagagcctatatgacttat
gctggtagtggtgttggcgttagcttattaggtacattgtcagttcagaaagatgtattt
gatgcgacaaatatcacaggttatagcactcaagttgcagaaggtaatgttattcatgat
gtcggcttaaatggacacgcagatactgcttctggttttagcacagtaactagcgttgaa
tttaacggcacagcatttgctgttaatgcgacaggtgtcacaaccattgtcggtgaccac
ggtacattgtcaatttatgctaatggtaactacagctatcagccaaatggtgaggctgca
agccttggtcaagttgatcaatttacttacaccttgtcagatggtctaaatacatcgcaa
gcgaccttgtatctccatattgatagcgatgcagtcgatatgacttggaatacaagtgat
ccatcacaacctgctgtcatcacagttactcctgtagacgcgattgataacgttgtttct
gctggtgtagatatcgttcctcaaggcgagcttggtgtagctgtaggttctgcaacttat
ctagcattggtgggcattacagaggacttaaatgtttccttgttaggaacaccaagtgtt
gcatttacaattgatgctggacacgaagctgatgtgacattcgcatatgctccagtgctt
tcattatcattgtttaatgactataaagttgtattacagcaaaaaggtgctgatggtgct
tggcataatattgacggcggctcaagtactggcttactcaatattggtttactaggtaac
ggtggaattggtgttactgttccagatctaggccaaggtgaataccgtgcatttatggtt
tacaccggtttaggagtaggtatcctaggtacaatgagtgtagtgaaagatgactttgat
tacacagttgcgcctaccaatacagcggttgttgcagatggtaatgtattgactgatgac
gtaactacgttaactactcaagttaccactgtgacatctgaagtagtgggtgctctacca
caaactgtcggaacagatacagttataaacggtgcatacggtacattggtgatttctaca
aatggtcactacacctatacaccaaatacaactgatctgagcgcgattggtaaagtggat
tcattcacttatacaattcgtgatgtattaacaggggcaacagatacagcgacattacat
gttcaggttggttcaccagacgtaacgatcgcatgggatgctgctaacccagcaaatgat
ggcgtagtacaattaactgctaatcctgatcatgtggttacaactacagacttctcaaat
gctgctgatctaccagtagatgtggcgagccctgtggtttctgtaaacctcatcggttct
aattcagtagtgtctgatcagtttgtagtaggagctggaactgttgctaatattgatcta
tcagcggtttatacagcacaacctttagcaagtgtactaccgacagtaagttatgtgatc
caaagctggaatggtacagcatgggtgaatacaatttactcaggttctcaaactgctcta
ggaagtgtggcaactattcaagcgggtagtgttgcattccaagacactgttgagcattta
gctgcaggtacctaccgcgtacaatatacgctaacaggtgtttcacttggtgcgacttca
ctagatacaaatgtttctacaacgacagttcatctagatacttatcgttcagattggatc
agcggaaatgtgttggcaggagacaacattggtggagtagcggatacaggcatcttgtct
catgaaggagctaaactccaagtttgggataatgcacaaaatgcttatgttgatgcagtt
ggacaaacaatcaataccggtaacggtgtattgattatgcaatcaaatggtgaatatgag
taccgtccaaatgatgtgactacaaccacacaattggcgtctactgacagtattaactat
aagattgtgtccgtaactggtggagttgaatctcaatcaaccttaacgattgatttaaca
catactgattacaatcttctttacacaagtacttctgcgaatgacacattcacaacaggt
acgggttcagatactgtgatttatcaattgttgaatggaactgctgctacagctaacaat
ggtgcaaatacaggtggtaacggtgtagatacttggactgacttccatgttggtaatgtt
gctacagacaaacaagctgatctgattgatatcagagccttgttagatggagatcaaaca
gatgctaatattggacaatatctgaatgtcactacaagtggtggtaacactacaattcag
attgaccgtgatggattatcaggactcatcccaggtaataacttcactacattgttagtc
ttacaaggtgttactacaacagagactgaattacttaacaatggtcaaattctctattaa

DBGET integrated database retrieval system